KEGG   Saccharomyces cerevisiae (budding yeast): YMR278WHelp
Entry
YMR278W           CDS       T00005                                 

Gene name
PRM15, PGM3
Definition
phosphoglucomutase PGM3 (EC:5.4.2.2)
Orthology
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YMR278W (PRM15)
   00030 Pentose phosphate pathway
    YMR278W (PRM15)
   00052 Galactose metabolism
    YMR278W (PRM15)
   00500 Starch and sucrose metabolism
    YMR278W (PRM15)
   00520 Amino sugar and nucleotide sugar metabolism
    YMR278W (PRM15)
  Nucleotide metabolism
   00230 Purine metabolism
    YMR278W (PRM15)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YMR278W (PRM15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:822763..824631
Genome map
AA seq 622 aa AA seqDB search
MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL
RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL
KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL
KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP
EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY
QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG
YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF
KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH
KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK
LTWNVLRREWFRPDEMNIVTKF
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaggaattttagaaaccgtaccatctgacttgaaagatccgatatcattatgg
tttaagcaagaccgcaacccaaaaactatagaagaggtcaccgctctctgcaaaaaatcc
gactggaatgagttacacaaaagatttgattctagaattcagtttggcactgctggttta
agatcgcaaatgcaagctggctttagcaggatgaatactttagtagtcatacaagcgtct
cagggattggcaacttatgtaagacaacagtttccagacaatttggtagctgttgtggga
cacgatcatagattccattctaaggagttcgctagagctactgctgctgcatttctttta
aaaggatttaaggtacattatttgaatcctgaccacgaatttgttcatacccctttagtt
ccctttgcagtggataagctaaaggcctccgttggcgtaatgataacagcaagtcacaac
ccaaaaatggataatggatataaagtatactattccaatggatgccaaatcattccacct
cacgatcatgccatctctgattccattgacgcaaatttagaaccatgggccaatgtgtgg
gatttcgacgatgttctaaataaggctctcaaacaagggaaattgatgtattccagagaa
gaaatgctgaagttatatttagaggaggtttctaaaaatctggtagaaatcaacccatta
aagcttgaagtaaaagccaaaccttggttcgtttacactccaatgcatggggttggattt
gacattttcagcaccatcgtaaaaaaaacactgtgcctggtagaaggtaaggattaccta
tgtgttcctgaacaacaaaatccagatccttctttcccaactgttggatttcctaaccct
gaagaaaaaggtgctttagacattggtataaacttggctgaaaaacatgacattgactta
cttgttgccaacgaccctgacgctgatagattctctgttgctgttaaagatatgcagtca
ggcgaatggcgacaactaacaggtaacgaaatcggttttctttttgcattttatgaatat
cagaaatataaaagtatggacaaagaatttcagcacgttcatccgttggctatgttaaat
tcaacagtgtcttcacaaatgataaaaaaaatggcagaaatagaagggttccattatgag
gatacattaacaggatttaagtggatcggaaatcgtgccatactcttggaaaagaaaggc
tattacgttccttttggattcgaggaagcaataggctacatgtttccagcaatggagcat
gataaggatggtatcagtgcatccattgtcttcttgcaagcctactgtaagtggaaaata
gaccacaatttggacccgctaaatgtcttagaaaatggcttcaaaaaatatggcgtgttc
aaagagtacaatggctattatgtcgttccaaatccaactgttacaaaagatatatttgac
tacatcaggaatgtctacactcctgagggcgcgtcatatccttcatctattggtgaagaa
atcgaagtactttactatcgagatttaaccactggttaccaatcggataccataaatcat
aaacctactctacccgtcgatcctacatcacaaatgataacagtatctgctagaccaagt
aacggtagtgagaatgagcatatccgcttcactattcgcgggtccggaacagaaccaaaa
cttaaagtatatattgaagcttgcgcaaatgaagaacaaagagcctctttcttggcgaaa
ttgacttggaatgtgctgagacgtgaatggtttagaccagatgaaatgaatatagttaca
aaattttga

DBGET integrated database retrieval system