KEGG   Saccharomyces cerevisiae (budding yeast): YMR303CHelp
Entry
YMR303C           CDS       T00005                                 

Gene name
ADH2, ADR2
Definition
alcohol dehydrogenase ADH2 (EC:1.1.1.190 1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sce01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sce00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sce00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIII:complement(873291..874337)
Genome map
AA seq 348 aa AA seqDB search
MSIPETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTK
LPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGY
THDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVYKALKSANLRAGHWAAISGAA
GGLGSLAVQYAKAMGYRVLGIDGGPGKEELFTSLGGEVFIDFTKEKDIVSAVVKATNGGA
HGIINVSVSEAAIEASTRYCRANGTVVLVGLPAGAKCSSDVFNHVVKSISIVGSYVGNRA
DTREALDFFARGLVKSPIKVVGLSSLPEIYEKMEKGQIAGRYVVDTSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctattccagaaactcaaaaagccattatcttctacgaatccaacggcaagttggag
cataaggatatcccagttccaaagccaaagcccaacgaattgttaatcaacgtcaagtac
tctggtgtctgccacaccgatttgcacgcttggcatggtgactggccattgccaactaag
ttaccattagttggtggtcacgaaggtgccggtgtcgttgtcggcatgggtgaaaacgtt
aagggctggaagatcggtgactacgccggtatcaaatggttgaacggttcttgtatggcc
tgtgaatactgtgaattgggtaacgaatccaactgtcctcacgctgacttgtctggttac
acccacgacggttctttccaagaatacgctaccgctgacgctgttcaagccgctcacatt
cctcaaggtactgacttggctgaagtcgcgccaatcttgtgtgctggtatcaccgtatac
aaggctttgaagtctgccaacttgagagcaggccactgggcggccatttctggtgctgct
ggtggtctaggttctttggctgttcaatatgctaaggcgatgggttacagagtcttaggt
attgatggtggtccaggaaaggaagaattgtttacctcgctcggtggtgaagtattcatc
gacttcaccaaagagaaggacattgttagcgcagtcgttaaggctaccaacggcggtgcc
cacggtatcatcaatgtttccgtttccgaagccgctatcgaagcttctaccagatactgt
agggcgaacggtactgttgtcttggttggtttgccagccggtgcaaagtgctcctctgat
gtcttcaaccacgttgtcaagtctatctccattgtcggctcttacgtggggaacagagct
gataccagagaagccttagatttctttgccagaggtctagtcaagtctccaataaaggta
gttggcttatccagtttaccagaaatttacgaaaagatggagaagggccaaattgctggt
agatacgttgttgacacttctaaataa

DBGET integrated database retrieval system