KEGG   Saccharomyces cerevisiae (budding yeast): YNL071WHelp
Entry
YNL071W           CDS       T00005                                 

Gene name
LAT1, ODP2, PDA2
Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YNL071W (LAT1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YNL071W (LAT1)
   00020 Citrate cycle (TCA cycle)
    YNL071W (LAT1)
   00620 Pyruvate metabolism
    YNL071W (LAT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YNL071W (LAT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:491523..492971
Genome map
AA seq 482 aa AA seqDB search
MSAFVRVVPRISRSSVLTRSLRLQLRCYASYPEHTIIGMPALSPTMTQGNLAAWTKKEGD
QLSPGEVIAEIETDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFK
DFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLA
KTIALEKGISLKDVHGTGPRGRITKADIESYLEKSSKQSSQTSGAAAATPAAATSSTTAG
SAPSPSSTASYEDVPISTMRSIIGERLLQSTQGIPSYIVSSKISISKLLKLRQSLNATAN
DKYKLSINDLLVKAITVAAKRVPDANAYWLPNENVIRKFKNVDVSVAVATPTGLLTPIVK
NCEAKGLSQISNEIKELVKRARINKLAPEEFQGGTICISNMGMNNAVNMFTSIINPPQST
ILAIATVERVAVEDAAAENGFSFDNQVTITGTFDHRTIDGAKGAEFMKELKTVIENPLEM
LL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctttgtcagggtggttccaagaatatccagaagttcagtactcaccagatca
ttgagactgcaattgagatgctacgcatcgtacccagagcacaccattattggtatgccg
gcactgtctcctacgatgacgcaaggtaatcttgctgcttggactaagaaggaaggtgac
caattgtctcccggtgaagttattgccgaaatagaaacagacaaggctcaaatggacttt
gagttccaagaagatggttacttagccaagattctagttcctgaaggtacaaaggacatt
cctgtcaacaagcctattgccgtctatgtggaggacaaagctgatgtgccagcttttaag
gactttaagctggaggattcaggttctgattcaaagaccagtacgaaggctcagcctgcc
gaaccacaggcagaaaagaaacaagaagcgccagctgaagagaccaagacttctgcacct
gaagctaagaaatctgacgttgctgctcctcaaggtaggatttttgcctctccacttgcc
aagactatcgccttggaaaagggtatttctttgaaggatgttcacggcactggaccccgc
ggtagaattaccaaggctgacattgagtcatatctagaaaagtcgtctaagcagtcttct
caaaccagtggtgctgccgccgccactcctgccgccgctacctcaagcactactgctggc
tctgctccatcgccttcttctacagcatcatatgaggatgttccaatttcaaccatgaga
agcatcattggagaacgtttattgcaatctactcaaggcattccatcatacatcgtttcc
tccaagatatccatctccaaacttttgaaattgagacagtccttgaacgctacagcaaac
gacaagtacaaactgtccattaatgacctattagtaaaagccatcactgttgcggctaag
agggtgccagatgccaatgcctactggttacctaatgagaacgttatccgtaaattcaag
aatgtcgatgtctcagtcgctgttgccacaccaacaggattattgacaccaattgtcaag
aattgtgaggccaagggcttgtcgcaaatctctaacgaaatcaaggaactagtcaagcgt
gccagaataaacaaattggcaccagaggaattccaaggtgggaccatttgcatatccaat
atgggcatgaataatgctgttaacatgtttacttcgattatcaacccaccacagtctaca
atcttggccatcgctactgttgaaagggtcgctgtggaagacgccgctgctgagaacgga
ttctcctttgataaccaggttaccataacagggacctttgatcatagaaccattgatggc
gccaaaggtgcagaattcatgaaggaattgaaaactgttattgaaaatcctttggaaatg
ctattgtga

DBGET integrated database retrieval system