KEGG   Saccharomyces cerevisiae (budding yeast): YNL071WHelp
Entry
YNL071W           CDS       T00005                                 

Gene name
LAT1, ODP2, PDA2
Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sce00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sce00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:491523..492971
Genome map
AA seq 482 aa AA seqDB search
MSAFVRVVPRISRSSVLTRSLRLQLRCYASYPEHTIIGMPALSPTMTQGNLAAWTKKEGD
QLSPGEVIAEIETDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFK
DFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLA
KTIALEKGISLKDVHGTGPRGRITKADIESYLEKSSKQSSQTSGAAAATPAAATSSTTAG
SAPSPSSTASYEDVPISTMRSIIGERLLQSTQGIPSYIVSSKISISKLLKLRQSLNATAN
DKYKLSINDLLVKAITVAAKRVPDANAYWLPNENVIRKFKNVDVSVAVATPTGLLTPIVK
NCEAKGLSQISNEIKELVKRARINKLAPEEFQGGTICISNMGMNNAVNMFTSIINPPQST
ILAIATVERVAVEDAAAENGFSFDNQVTITGTFDHRTIDGAKGAEFMKELKTVIENPLEM
LL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctttgtcagggtggttccaagaatatccagaagttcagtactcaccagatca
ttgagactgcaattgagatgctacgcatcgtacccagagcacaccattattggtatgccg
gcactgtctcctacgatgacgcaaggtaatcttgctgcttggactaagaaggaaggtgac
caattgtctcccggtgaagttattgccgaaatagaaacagacaaggctcaaatggacttt
gagttccaagaagatggttacttagccaagattctagttcctgaaggtacaaaggacatt
cctgtcaacaagcctattgccgtctatgtggaggacaaagctgatgtgccagcttttaag
gactttaagctggaggattcaggttctgattcaaagaccagtacgaaggctcagcctgcc
gaaccacaggcagaaaagaaacaagaagcgccagctgaagagaccaagacttctgcacct
gaagctaagaaatctgacgttgctgctcctcaaggtaggatttttgcctctccacttgcc
aagactatcgccttggaaaagggtatttctttgaaggatgttcacggcactggaccccgc
ggtagaattaccaaggctgacattgagtcatatctagaaaagtcgtctaagcagtcttct
caaaccagtggtgctgccgccgccactcctgccgccgctacctcaagcactactgctggc
tctgctccatcgccttcttctacagcatcatatgaggatgttccaatttcaaccatgaga
agcatcattggagaacgtttattgcaatctactcaaggcattccatcatacatcgtttcc
tccaagatatccatctccaaacttttgaaattgagacagtccttgaacgctacagcaaac
gacaagtacaaactgtccattaatgacctattagtaaaagccatcactgttgcggctaag
agggtgccagatgccaatgcctactggttacctaatgagaacgttatccgtaaattcaag
aatgtcgatgtctcagtcgctgttgccacaccaacaggattattgacaccaattgtcaag
aattgtgaggccaagggcttgtcgcaaatctctaacgaaatcaaggaactagtcaagcgt
gccagaataaacaaattggcaccagaggaattccaaggtgggaccatttgcatatccaat
atgggcatgaataatgctgttaacatgtttacttcgattatcaacccaccacagtctaca
atcttggccatcgctactgttgaaagggtcgctgtggaagacgccgctgctgagaacgga
ttctcctttgataaccaggttaccataacagggacctttgatcatagaaccattgatggc
gccaaaggtgcagaattcatgaaggaattgaaaactgttattgaaaatcctttggaaatg
ctattgtga

DBGET integrated database retrieval system