KEGG   Saccharomyces cerevisiae (budding yeast): YNL090WHelp
Entry
YNL090W           CDS       T00005                                 

Gene name
RHO2
Definition
(RefSeq) Rho family GTPase RHO2
  KO
K07975  
Rho family, other
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Rho Family
   Others
    YNL090W (RHO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
XIV:456565..457143
Genome map
AA seq 192 aa AA seqDB search
MSEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRVDGIKVSLTLW
DTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIVLVGLK
KDLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSLLM
KKEPGANCCIIL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaggccgttagaaggaaacttgttattattggtgatggtgcttgtggcaag
acctctttactatatgtatttacattaggaaaattccctgaacaatatcatccgacagtg
ttcgagaattatgtcactgattgcagagttgacggaataaaagtgtccttaacgctctgg
gatacagcgggacaagaggaatatgaacgtttacgtccattctcatattcaaaagcagat
ataatattaattgggtttgctgtagacaattttgaatcactaattaacgcaaggacgaaa
tgggcggatgaggcattacgatattgtcctgacgcaccaatcgttcttgtaggcttgaaa
aaagatttgaggcaagaagcccattttaaagagaatgctaccgatgaaatggttcccatt
gaagatgcaaaacaagttgcaagggccattggggccaagaaatacatggaatgtagtgca
ctgactggtgagggtgtggatgatgtctttgaagtagctacaagaaccagtttgcttatg
aagaaggaaccaggggctaactgttgcataattttataa

DBGET integrated database retrieval system