KEGG   Saccharomyces cerevisiae (budding yeast): YNL097C-BHelp
Entry
YNL097C-B         CDS       T00005                                 

Gene name
YNL097C-A
Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:complement(440797..440919)
Genome map
AA seq 40 aa AA seqDB search
MTAKTKQSWNKGIWENGKQGSHQQTFLPKIWVNIYSTPTS
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaagacgaaacaaagctggaataaggggatctgggaaaacgggaaacaaggt
tcacatcagcaaacatttctaccgaaaatctgggtaaacatttatagtaccccaacatct
taa

DBGET integrated database retrieval system