KEGG   Saccharomyces cerevisiae (budding yeast): YNL117WHelp
Entry
YNL117W           CDS       T00005                                 

Gene name
MLS1
Definition
malate synthase MLS1 (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YNL117W (MLS1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YNL117W (MLS1)
   00630 Glyoxylate and dicarboxylate metabolism
    YNL117W (MLS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YNL117W (MLS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:406358..408022
Genome map
AA seq 554 aa AA seqDB search
MVKVSLDNVKLLVDVDKEPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQV
VQKKLDSGSYHLDFLPETANIRNDPTWQGPILAPGLINRSTEITGPPLRNMLINALNAPV
NTYMTDFEDSASPTWNNMVYGQVNLYDAIRNQIDFDTPRKSYKLNGNVANLPTIIVRPRG
WHMVEKHLYVDDEPISASIFDFGLYFYHNAKELIKLGKGPYFYLPKMEHHLEAKLWNDVF
CVAQDYIGIPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN
DPNHILPNRNQVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPAANEKAMTK
VRNDKIRELTNGHDGSWVAHPALAPICNEVFINMGTPNQIYFIPENVVTAANLLETKIPN
GEITTEGIVQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLYQWVKHGVTLKD
TGEKVTPELTEKILKEQVERLSKASPLGDKNKFALAAKYFLPEIRGEKFSEFLTTLLYDE
IVSTKATPTDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggtcagtttggataacgtcaaattactggtggatgttgataaggagcctttc
tttaaaccatctagtactacagtgggagatattcttaccaaggatgctctagagttcatt
gttcttttacacagaactttcaacaacaagagaaaacaattattggaaaacagacaagtt
gttcagaagaaattagactcgggctcctatcatctggatttcctgcctgaaactgcaaat
attagaaatgatcccacttggcaaggtccaattttggcaccggggttaattaataggtca
acggaaatcacagggcctccattgagaaatatgctgatcaacgctttgaatgctcctgtg
aacacctatatgactgattttgaagattcagcttcacctacttggaacaacatggtttac
ggtcaagttaatctctacgacgcgatcagaaatcaaatcgattttgacacaccaagaaaa
tcgtacaaattgaatggaaatgtggccaacttgcccactattatcgtgagaccccgtggt
tggcacatggtggaaaagcacctttatgtagatgatgaaccaatcagcgcttccatcttt
gattttggtttatatttctaccataatgccaaagaattaatcaaattgggcaaaggtcct
tacttctatttgccaaagatggagcaccacttggaagctaaactatggaacgacgtcttc
tgtgtagctcaagattacattgggatcccaaggggtacaatcagagctactgtgttgatt
gaaactttgcctgctgctttccaaatggaagagatcatctatcaattaagacaacattct
agtgggttgaattgcggacgttgggactatattttctctacaatcaagagattaagaaat
gatcctaatcacattttgcccaatagaaatcaagtgactatgacttccccattcatggat
gcatacgtgaaaagattaatcaatacctgtcatcggaggggtgttcatgccatgggtggt
atggctgcgcaaatccctatcaaagacgacccggcagccaatgaaaaggccatgactaaa
gtccgtaatgataagattagagagctgacaaatggacatgatgggtcatgggttgcacac
ccagcactggcccctatttgtaatgaagttttcattaatatgggaacaccaaaccaaatc
tatttcattcctgaaaacgttgtaacggctgctaatctgctggaaaccaaaattccaaat
ggtgagattactaccgagggaattgtacaaaacttggatatcgggttgcagtacatggaa
gcttggctcagaggctctggatgtgtgcccatcaacaacttgatggaagacgccgccact
gctgaagtgtctcgttgtcaattgtatcaatgggtgaaacacggtgttactctaaaggac
acgggagaaaaggtcaccccagaattaaccgaaaagattctaaaagaacaagtggaaaga
ctgtctaaggcaagtccattgggtgacaagaacaaattcgcgctggccgctaagtatttc
ttgccagaaatcagaggcgagaaattcagtgaatttttgactacattgttgtacgacgaa
attgtgtccactaaggcgacgcccactgatttgagcaaattgtga

DBGET integrated database retrieval system