KEGG   Saccharomyces cerevisiae (budding yeast): YNL172WHelp
Entry
YNL172W           CDS       T00005                                 

Gene name
APC1
Definition
anaphase promoting complex subunit 1
Orthology
K03348  
anaphase-promoting complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YNL172W (APC1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YNL172W (APC1)
   04113 Meiosis - yeast
    YNL172W (APC1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YNL172W (APC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:310636..315882
Genome map
AA seq 1748 aa AA seqDB search
MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIED
QCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWY
ANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASG
NKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTG
LDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFAL
PSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYL
NQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHF
CKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSE
GQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYI
TSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQE
YKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATA
AMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCP
FISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYP
LGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYM
LCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKL
NAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVG
WGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGL
RISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISI
GLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRH
KRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDD
LPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNN
FGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSE
LNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTI
SVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQ
VTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLA
LGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDIS
TGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDY
SASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNT
TSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWY
KSFGPHDE
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaagccgtctactagaaatgattatttaccaagggaaactcacaatggcgaa
tatactggtgattctcccgaatggcagttgcagattaatatcacaaacaaaataggtggt
ataaatggagatatttggttgtcaagggacggaaggagtgttaaatggtgtattgaagac
cagtgcttacgtcagtttacttataatcaaaagatcatcaaagctgggtacattgatttt
gaaaagacaccagattgttttgtggtagttctctctgatattgcgcatgtatatatgttg
aaaaatgggggttctacgactgtatgtttcccattccagataggtaatgcattctggtat
gcaaatggagtaattttagagagagagacttcagcgtccttcatggatggtggctacgat
ttaaaacccattgagttcgatttaaaacataaatacatcactttgacggatccgatggcg
cctttcggcttgatttcgatcacaaatacctttaaaggcggtataaatagcgcttcaggt
aacaaaacggatatcctgcaagactttcagctcgtgctcttcccgagtgacaaggacaag
tgtatagctgtttttttagatcgaaattccaaagtgttgcgattttattacagtagaatt
ctatcatcagatcagtcacggaagggagagctaacaatttcctcgaccaaaaaaacaggt
ttggacgcagcaggcaatagccaaaagagtggcgggattagcaaagatttgcgtaagttt
tcacatttgacgcgccggtcgacgtctataaactctaactctcatgatttcaatgcagcc
gaaagagtacttagtggcaatgttggcaacgcttcaggcagaacagatattttcgcttta
ccttcttcttgttcaagaaggagcttatctgcgaccctagatagaatggggaacaatatt
gccccgaccaatagagctgcaccttctggattttttgactcgtcatcagcaaatactgct
actcactctaatataacgcctgtatcacaaccaatgcaacagcaacagcaagaatatttg
aaccaaacagcgacctcttctaaggatattgttttgacggaaatatcgtctttgaaatta
ccggatgatatcatttttacttcacgacgcttgagctctattttaagtaaattaaagttc
ctatcgttgagatttgaacgtcgagaaggacttttaatatttcatgagcccacacatttc
tgcaaaatctggttgattgatcttttacccgatgttctggattctattccattcaaaata
tacgggaactctccgcaaaacatgatcagactagagaacttaaagcttaaggaaccctca
agaatacaagctatgtatattcatgaactccttgaaagttgcctgattttggtgtcggag
ggacagaataaggaagaatacaaagcatgtctatatgaccccttcgttaaaattacatcc
ccttccaaaaatatctccgaagagctcactaaacaaaattctcttccttccttacagaaa
ctattcccttatcccgagactagtttcaccaaactgtgcttcgaagccgtcaagtatatt
acttctcctgcattcaatatttcatttatatttctatggcaatctgcatattcgatactt
ctttcaagggctaacgacgacgtagttgggggtttgaaaatggagcacgatgctttttca
ctggttctttcattgctgattttaccgatacctagctcctctgctcaagaataccaggag
tacaaagaaatatatgaacgcgacctgtttcagcatttaaagcaggactcagaaataaca
agctctgtgctaccaagaattgttattggattgcatttaataagggaggaatattccctg
aatgtattgtgtcgaaatgagcatgcgttgttaggacagtttctaagattcgctactgcc
gcgatgggctggcctgatctgtggcaatcttactatgtaccgaaaatggattcagaatcg
aaaactttcctacatccaagggaacaaaattccactttttttcatcccttagatgaaccg
ccatcgattaccaagtcgttatacagcataactgaaaacagttcaataccattatgtccg
ttcattagtttctcgagacttgttgcaaccgatacacaggtcgaattacgcattactcca
agaagtttcaaaatcttgggcttgtatgaactcgtacactctccaaattttttaccggat
tatgttttaggcatcctttccagctttaaagtggataaagacgagttacaaacatatccc
ttaggcattttggtgcctttacaaaacattttaaaaattctggaagataagctatctgaa
gtaagagacaacttggagttattagatagggccgatttacaaaggtgtagtgccattatc
aatagtataagaagtgattctaaagaagttctcaaaagaggccaaagagatagttatatg
ttatgcaaagtgccactcgccaagaacagaagctctttgtctaagaagcccagtgacata
tattcaatattatccgagattgtgaaaagtgcaagtcaagttccactggatggatcagct
atgaggatgtcgaatattcaggatgatgaagatattgatgaaggtcgatctctcaaatta
aatgcaggactgattttttcagaagataaaagatttactcatgttgtatcactattagct
tattacaggcccacaaaaactcaattttttaccaccaagacagaatatgcccagatacta
gctcaaaagaaatatttcgctaaaatcatggctttgaggacatgtacaaatggtgttggc
tggggtgcagtggcatatgcaacagaaaaaccaatatctacccaaaaatgggtcattcaa
cccctcaacttaatttccgtgtttcctgatgacacaaagataactgtgaaagctccagaa
gatatagcacacgatattgtggagtgggggcaatttcatgccggtgttagctccggcctc
cgtatctcaaagaaggcaactggaattacaggtagttggattgcatttaataagccaaaa
gaactagatgcttatcacggtggtttccttctcggactgggacttaatgggcatttgaag
aatttagaggaatggcatatatacaattatctaagccccagaaatactcacataagtatt
gggttacttttgggaatgagttcaagtatgaaaggtagtatggactctaaactaatcaaa
gttattagtgtacacctagtggcctttcttccaagcggatctagcgatttgaatatagat
ctaaaactacaaactgctggtattatagggatgggtatgttatatttaaactcaaggcat
aaacgaatgagcgattcaatttttgcccagctggtgtcactgctcaatgtaaatgatgaa
atggttgctgacgaagaatatcgattagcagcgggtatatcgctgggcctcataaaccta
ggggctggtcagacgaaactgagaaagtgggattcatcattgttgggcttgggggacgat
cttccggaagatgtttatgactctagtgatgttgaacaaaatgtaatgtatgaagacctg
actacgaagttattagagatcgtcacaagcacatatgatgtagaaaacgattggatacca
gagaattcgcaaattggcgcagtaattgcaatcatgtttttatttttgaagtcaaacaat
tttggaatttccaacatgcttaaagttgacttaaaggaaatattaaaagcaaatattaac
acccgccctgaattattaatgtaccgagaatgggcatccaatatgattttatgggaattt
ataggcgacgacctatcgttcatcatgaaagatgttgatattggagtaaaatttagtgaa
cttaataccgatttgcttcctatatattacactatggcgggtaggatcttagccatgggt
attagatttgcctctactggaaatttgaaaattcggaatatactgctttctctcgttgat
aagtttctgcctctttatcagtacccaggaaagcagaatctagactttaggttgacaatt
tctgttattaacgttttaactaatgtcatcgttgtttctttgagcatggttatgtgtgcc
agtggcgatttagaagttttgaggagggtcaaatatcttcatgaagttgcatctggtcca
tattcagacttatttcaagaaattcctagttctaaaagtgatgtttcaggtgtaacacag
gtgacttcaaacactaacacgcctggaaatagtgatcgtgaaagggttgatgagaccgct
gcttctctcgatgacgaaaggtcctcaaatggcagtgatattagtgatccaacagcatat
ctagaagacaaaaaggatatagatgaccattacggtaagtttatttcgacaaatcttgca
ctgggttttcttttccttgggtctggacaatacgctctcaatacttctactttagaatct
atcgctttcttaagcatgtccgttttacccacatatacaactccacatcccttacaagaa
ttgaagcatttctggagcatggctgtagagcctcgttgccttgttataaaggacatttcc
actggtgacgcagtaaacaacgttcctattgaattggtggtcgaggaagacgtcgaaaaa
gaagaagtaataagagagatatcaacaccttgcctgcttcctgatttctccaaaattaaa
tctattagggtaaaaatgcatggttactttccactggaagtaaatttcactaaggactac
tcagcttctgatttttttagtggcggtacaattatttatatacaaagaaaatccgaaagt
gttttcgagaacaaagcctcttttaggaacgtagaagatattcatgtggcactcaaaaga
aaggcagcagaatctaaaaattattcaagattaaacctaaaaaatgaacaaggaaatacc
acctcttcgcaactggttgaaagtttgggtattcaagatttgacaatggtggaactcgat
actcttttgagtgcaggaaataatacagcattaacggattcagaatcttataatttaggt
ttgctgtgttcagataaaaacagtggagatattttggattgccaactcgaattgtggtac
aaaagctttggaccacatgatgaataa

DBGET integrated database retrieval system