KEGG   Saccharomyces cerevisiae (budding yeast): YNL186WHelp
Entry
YNL186W           CDS       T00005                                 

Gene name
UBP10, DOT4
Definition
Ubp10p (EC:3.4.19.12 3.1.2.15)
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:289498..291876
Genome map
AA seq 792 aa AA seqDB search
MTTQESIKPLVDRILSNPLQFNAAMISNKSNNNDTSAAPENSSYIVIGKQHNNNSNSTAI
AATAESKQIKENNLIDRPNGKKTNTVPKSMAEALLLYTSKNDKDAADATGAKKSAELSTE
LSTEPPSSSSEDDKVGKEEEEEGEIFHEARDYVEPRKASLKERDNADKGDGEDIGEDIGE
DIGEDIGEDIGEDIGENLGSPLATIDDSSNENEKEKRKELSTSISSDDEIEDDEDEDDMD
YDSSAMEKELPEEEENDSSSKISEGEKKSLYQDLMENSTVEVNRYEPVNNTKENGNRNPK
GEEEEEEEEELKHKSRSITPPVTISNLSNFYQFNENINDRGSLNSTRIVKNWGDKFTNLK
PRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGKYDSTISKNSVSYTLAETSKKMWL
PVSKNPRKNVSASYINPKHLISRLDDINCMMSEWQQEDSHEYFMSLMSRLQEDSVPKGHK
LIESIIYDIFGGLLKQIVTCKSCGSISKTEQPFYDLSLHLKGKKKLDPNSDLSSDSINGT
SATTSTTTSNAATKPSLSSSSSVNLNNGSPFAAASDLSSANRRFSIEKSIKDFFNPELIK
VDKEQKGYVCEKCHKTTNAVKHSSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLD
LTEYCESKELPVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVL
KEPNAYYLLYTRLTPKSVPLPLAKSAMATGNVTSKSKQEQAVNEPNNRPLKINSKKNNRK
KWKKNKKRKFTK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcaagaatcgatcaaacctttggtagatagaatcctatcaaatcccctgcag
ttcaatgctgcaatgatctctaacaaatcgaataataatgatacttccgccgcgccggaa
aatagctcgtatattgtgataggaaaacagcataataacaatagtaatagcacagctatt
gctgcaacggccgaatccaagcaaataaaagaaaataacttgatagacaggccaaacgga
aagaaaaccaacactgttcctaaatctatggctgaagctttattgttgtatacttctaaa
aatgataaagatgctgcagatgctactggtgccaagaagtcagcggagctttctacggag
ctttctacggagcctccttcctcttcttcggaagatgacaaagtaggaaaagaggaagag
gaagagggtgaaatatttcatgaggcaagagactatgtagaaccccgaaaagctagtttg
aaggaacgcgacaacgcagataagggcgatggtgaagacatcggcgaagacatcggtgaa
gacatcggtgaagacatcggtgaagacattggtgaagacattggtgaaaacttgggttct
ccattagcaaccattgatgattcatctaatgagaatgaaaaggaaaaaagaaaggaactg
tctacaagcattagcagtgatgacgaaatagaagacgacgaggatgaggatgacatggat
tatgattctagtgctatggaaaaagagctccctgaagaagaggagaacgattccagctcc
aaaatttctgaaggcgaaaaaaagagtttatatcaagatttaatggaaaatagtacagtg
gaagtaaatcggtacgaaccagtaaacaacaccaaagaaaatggaaacaggaatccaaag
ggagaggaggaggaagaagaggaagaagagctgaaacataaatctaggtcaatcacccct
ccggttacaatatcaaatctatcaaacttttaccaattcaatgaaaatatcaatgatcgt
ggttctttaaactctactagaattgttaaaaattggggcgacaaattcaccaatttgaag
cctcgtggccttttgaatcatggtgttacttgttacacaaatgctgctgtacaggctatg
ttacacattccttcgatacaacattatctttttgatatactaatggggaaatacgatagc
accatctcaaaaaattccgtttcctatactttagctgaaacaagtaaaaaaatgtggtta
ccggtctcaaaaaaccctagaaagaacgtttcagcttcctacattaatccaaaacatttg
atttccagattggatgacattaattgtatgatgagcgaatggcagcaggaagattcacat
gagtacttcatgtctctgatgtcaagattacaggaagattctgttcccaagggtcataaa
cttatagaatcgataatatatgacatattcggtggtcttttaaagcagatcgttacttgc
aaatcttgtggcagtatatctaaaacagaacaaccattttacgatttatcgttgcacttg
aaagggaagaaaaaacttgatccaaattctgacctgtcgagtgatagcattaacggcact
tcagccaccacttctaccactacctccaatgctgccacaaaaccatctctttcatcctct
tcatctgtcaatttaaacaatggctcaccatttgccgctgccagtgatttaagttcagcc
aaccgcagattttctattgaaaaatcaattaaagatttcttcaatcccgaattaatcaag
gttgacaaggagcaaaagggttacgtttgtgagaagtgtcacaagaccacgaacgccgtg
aagcatagttcaatattaagggctcctgaaactttacttgtgcatctgaaaaaattcaga
ttcaatggcacgtcctcatcaaaaatgaagcaagctgtttcttatcctatgtttttagat
ttgacggaatattgtgagagtaaagagctacctgtcaaataccaactattaagcgtggtg
gttcatgagggccgctccctttcttcaggtcactacattgcccactgcaagcaaccagac
ggtagctgggccacttacgacgacgagtatattaatataatatctgaaagggacgtttta
aaggaacccaacgcatattatctcctatacacgaggctaactccaaaatcggttccattg
ccattggcgaaatctgccatggccactggtaatgttacctctaaatccaaacaggaacag
gctgttaacgaaccaaataaccgcccattgaagattaatagcaagaaaaataacagaaaa
aaatggaaaaaaaataaaaaaaggaagttcaccaaatga

DBGET integrated database retrieval system