KEGG   Saccharomyces cerevisiae (budding yeast): YNL256WHelp
Entry
YNL256W           CDS       T00005                                 

Gene name
FOL1
Definition
trifunctional dihydropteroate synthetase/dihydrohydroxymethylpterin pyrophosphokinase/dihydroneopterin aldolase FOL1 (EC:4.1.2.25 2.7.6.3 2.5.1.15)
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YNL256W (FOL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     YNL256W (FOL1)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     YNL256W (FOL1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     YNL256W (FOL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIV:164623..167097
Genome map
AA seq 824 aa AA seqDB search
MSKLFSTVNSARHSVPLGGMRDYVHIKKLEMNTVLGPDSWNQLMPQKCLLSLDMGTDFSK
SAATDDLKYSLNYAVISRDLTNFVSKKKNWGSVSNLAKSVSQFVMDKYSGVECLNLEVQA
DTTHIRSDHISCIIQQERGNPESQEFDVVRISELKMLTLIGVFTFERLKKQYVTLDIKLP
WPKKAELPPPVQSIIDNVVKFVEESNFKTVEALVESVSAVIAHNEYFQKFPDSPLVVKVL
KLNAITATEGVGVSCIREPREIAMVNIPYLSSIHESSDIKFQLSSSQNTPIEGKNTWKRA
FLAFGSNIGDRFKHIQMALQLLSREKTVKLRNISSIFESEPMYFKDQTPFMNGCVEVETL
LTPSELLKLCKKIEYEELQRVKHFDNGPRTIDLDIVMFLNSAGEDIIVNEPDLNIPHPRM
LERTFVLEPLCELISPVHLHPVTAEPIVDHLKQLYDKQHDEDTLWKLVPLPYRSGVEPRF
LKFKTATKLDEFTGETNRITVSPTYIMAIFNATPDSFSDGGEHFADIESQLNDIIKLCKD
ALYLHESVIIDVGGCSTRPNSIQASEEEEIRRSIPLIKAIRESTELPQDKVILSIDTYRS
NVAKEAIKVGVDIINDISGGLFDSNMFAVIAENPEICYILSHTRGDISTMNRLAHYENFA
LGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGF
AKTWKQNLQIIRHIPILKNYSFTMNSNNSQVYVNLRNMPVLLGPSRKKFIGHITKDVDAK
QRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAIYKGLE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagctattttctactgtcaattctgcaagacatagtgtaccactaggcggcatg
agagattatgtgcacattaagaaactagagatgaatacagttcttgggcctgattcctgg
aatcaattaatgcctcagaaatgtctactaagcttagatatgggtacagattttagtaaa
tctgcggctacggatgatttgaaatattctctaaattatgcagttatttctcgtgatttg
acgaatttcgtcagcaaaaaaaagaattggggttctgtttctaatttggctaaatctgtg
tctcaatttgttatggacaaatattctggtgtcgagtgtctgaatttagaagtgcaggcg
gatacaacgcatattagaagtgaccacatatcttgtattattcaacaagaaagagggaat
ccagaatcacaggaatttgacgttgttaggatatctgagttaaaaatgttgactttgatt
ggtgttttcacctttgagagacttaagaaacagtatgtaactttggatataaagttgcct
tggccaaagaaagccgaattgccaccgccagtgcaaagcataattgataacgttgtcaag
tttgtggaggaatcaaatttcaagactgtggaagctcttgtagaatctgtgtcagctgtt
attgcccataacgagtattttcaaaagtttccagattcgcctttggtggtgaaggttttg
aaattaaacgcaatcacagccacagaaggtgttggtgtaagctgtattagagagcccagg
gagattgcgatggtaaatattccatatctttcctccatacatgaatcgtctgatattaag
ttccaattgtcttcatcacaaaacactcctattgagggtaaaaatacatggaaaagagcg
tttttagcgtttggttcaaacattggggaccgtttcaaacacattcaaatggcgttgcaa
ttattatcaagggaaaaaacggttaaattacggaatatttcgtctatttttgaaagtgaa
ccaatgtatttcaaagatcaaacccctttcatgaatgggtgtgttgaggtggagacatta
ctgaccccaagcgaattattaaaattgtgtaaaaaaattgaatatgaagagttgcaaaga
gtcaagcattttgataatggtccgagaacaatagatctggatattgttatgtttttgaat
agcgccggagaagatattatagtaaatgaaccggatttgaatataccgcatcctagaatg
ctggagaggactttcgttcttgagccgttatgtgaattaatatcccccgttcaccttcat
cctgtgacagcggaacccattgtagaccatttaaaacagttatacgacaaacagcatgat
gaagataccttatggaaattagttccattgccttatcgtagtggtgtggagcctagattt
ttgaaattcaagaccgctacaaaacttgacgaatttactggagaaacaaacagaattact
gtttcacctacatatatcatggctatcttcaacgctacaccagattcattttccgatgga
ggtgagcattttgcggacattgaaagtcaattgaatgatatcattaaattgtgtaaagac
gcattatatttgcatgagagcgtcatcatcgacgttggagggtgttctaccaggcctaac
tctattcaggcgtctgaggaagaagaaatacgcaggtctatcccattaattaaggccatt
agagaaagcactgagttaccgcaagataaagtcatactatccattgatacttatcgttcc
aatgtcgctaaagaagcgattaaagttggagtggatattattaatgatatttcgggaggt
ttatttgacagcaacatgtttgccgtaattgcagagaacccagaaatttgttatatttta
tcacacacacgtggtgatatttcaacgatgaataggctggcgcattacgaaaattttgca
ttgggtgattctattcagcaagaatttgttcataataccgacattcagcagctagacgac
ttgaaagacaaaacagtgttaatcaggaatgttggtcaagaaattggcgaaaggtatatc
aaagcgattgataatggagtaaagcgctggcaaattctaatcgaccctggacttggtttt
gctaagacctggaagcaaaacttacaaattattagacatatccccattttaaagaactac
tcattcaccatgaactcaaacaattcgcaagtgtatgttaacctcagaaatatgcccgtt
ttattgggtccatcgcgcaaaaaattcattggacatatcacaaaagatgtggatgcgaag
caaagagactttgctactggagcggtggtagcgtcgtgtattggtttcggcagcgacatg
gttagggtccatgacgttaaaaattgttcgaagagcattaaattagcagatgctatttat
aaaggtttggaataa

DBGET integrated database retrieval system