KEGG   Saccharomyces cerevisiae (budding yeast): YNL261WHelp
Entry
YNL261W           CDS       T00005                                 

Gene name
ORC5
Definition
origin recognition complex subunit 5
Orthology
K02607  
origin recognition complex subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YNL261W (ORC5)
   04113 Meiosis - yeast
    YNL261W (ORC5)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YNL261W (ORC5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:155100..156539
Genome map
AA seq 479 aa AA seqDB search
MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAV
WLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYE
SLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYS
THCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLS
ENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGR
AAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEV
FQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaccactccggaagttgcttttagggaatatcaaaccaactgtctcgcatcg
tatatttctgctgatccagacataactccttcaaatttaatcttgcaaggttatagtgga
acaggaaaaacctacactttgaagaagtattttaatgcgaatccaaatttgcatgcagta
tggctggaacctgttgagttggtttcttggaagcccttactgcaggcgatagcacgtact
gtacaatataaattgaaaaccctatatccaaacattcccaccacagattacgatccttta
caggttgaagagccatttcttttggtaaagacgttgcacaatatttttgtccaatatgaa
tctttgcaagaaaagacttgcttgttcttgatattggatggtttcgatagtttacaagat
ttagacgccgcactgtttaacaaatatatcaaactaaatgaattacttccaaaagattct
aaaattaatataaaattcatttacacgatgttagagacatcatttttgcaaagatattct
acacattgcattccaactgttatgtttccgaggtataatgtggacgaagtttctactata
ttagtgatgtctagatgtggcgaactcatggaagattcttgtctacgtaagcgtatcatt
gaagagcagataacggactgtacagacgatcaatttcaaaatgtagctgcgaacttcatt
cacttaattgtgcaggcttttcattcttatactggaaacgacatattcgcattgaatgac
ttgatagacttcaaatggcccaagtatgtatctcgcattactaaggaaaacatatttgaa
ccactggctctttacaaaagtgccatcaaactatttttaagcacagatgataatttaagt
gaaaatggacaaggtgaaagcgcgataaccacaaatcgtgatgaccttgagaacagtcaa
acttacgacttatcaataatttcgaagtatctgctcatagcctcatatatttgttcatat
ctggaacctagatacgatgcgagtattttctctaggaaaacacgtatcatacaaggtaga
gctgcttatggacgaagaaagaagaaagaagttaaccctagatatttacagccttcttta
tttgctattgaaagacttttggctattttccaagctatattccctattcaaggtaaggcg
gagagtggttccctatctgcacttcgtgaggaatccttaatgaaagcgaatatcgaggtt
tttcaaaatttatccgaattgcatacattgaaattaatagctacaaccatgaacaagaat
atcgactatttgagtcctaaagtcaggtggaaagtaaacgttccctgggaaattattaaa
gaaatatcagaatctgttcatttcaatatcagcgattacttcagcgatattcacgaatga

DBGET integrated database retrieval system