KEGG   Saccharomyces cerevisiae (budding yeast): YNL289WHelp
Entry
YNL289W           CDS       T00005                                 

Gene name
PCL1, HCS26
Definition
Pcl1p
Orthology
K06656  
G1/S-specific cyclin PLC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YNL289W (PCL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:87897..88736
Genome map
AA seq 279 aa AA seqDB search
MCEYSKALHILLKSPVTDDIIKFLTDTTLRVVPSSNYPTPPGSPGEKHLTRLPSLMTFIT
RLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFHNDSSPLN
KHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDLILDLQPLLEPIKQDLARSSDQR
KRINMMMSMNRRTCAGTSPIRSNNRFKLYEKQRNVSIASDLSSATLVDSCNDLRRLKDVT
NIANNTVANTNYVRTVEKWNDNVNRQSWDLEQIMSQHGF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaatacagcaaggctcttcatattctgctcaagtcgccagtaacggatgacata
ataaaattcttaacagacacaacattgagggttgttccttcaagcaactaccccacgcct
cccggttctccaggagagaaacacctcacaaggctgccatcgctaatgacttttatcact
agattggtcagatacaccaacgtctacacacccactctgctcaccgctgcgtgctatttg
aacaaattaaagcgtattctgcccagggacgctactggtctcccctcgaccatccatcgc
attttcttggcctgtttgatactgagtgctaagtttcacaatgactcttctcctttaaac
aagcactgggctaggtacaccgatggtctctttacactagaggatatcaaccttatggaa
aggcagttgttacagctgttgaactgggacctcagggtgaacacagaagatttgatccta
gatctgcagcctctattagagcccatcaagcaagacttggcaagatccagcgaccaaagg
aagagaattaacatgatgatgtccatgaacagaaggacttgtgctggcacgagtcctatc
agatcaaacaacagattcaaactctacgaaaaacagagaaacgtgtcgatagcatccgat
ttaagttctgctactctagtcgacagttgtaatgatctaagaaggctaaaagatgtaacc
aacatagcgaacaacacagtcgctaacacgaattacgtcaggacggtagagaaatggaac
gacaatgtcaacaggcaaagttgggatctggaacagatcatgagtcaacatgggttttaa

DBGET integrated database retrieval system