KEGG   Saccharomyces cerevisiae (budding yeast): YNL312WHelp
Entry
YNL312W           CDS       T00005                                 

Gene name
RFA2, BUF1, RPA2, RPA32
Definition
Rfa2p
Orthology
K10739  
replication factor A2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YNL312W (RFA2)
   03420 Nucleotide excision repair
    YNL312W (RFA2)
   03430 Mismatch repair
    YNL312W (RFA2)
   03440 Homologous recombination
    YNL312W (RFA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:join(48287..48293,48402..49216)
Genome map
AA seq 273 aa AA seqDB search
MATYQPYNEYSSVTGGGFENSESRPGSGESETNTRVNTLTPVTIKQILESKQDIQDGPFV
SHNQELHHVCFVGVVRNITDHTANIFLTIEDGTGQIEVRKWSEDANDLAAGNDDSSGKGY
GSQVAQQFEIGGYVKVFGALKEFGGKKNIQYAVIKPIDSFNEVLTHHLEVIKCHSIASGM
MKQPLESASNNNGQSLFVKDDNDTSSGSSPLQRILEFCKKQCEGKDANSFAVPIPLISQS
LNLDETTVRNCCTTLTDQGFIYPTFDDNNFFAL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctatcaaccatataacgaatattcatcagtaacgggcggtggctttgagaac
tctgagtcccgcccaggtagtggggagtcggaaactaacactagagttaacaccttgaca
cctgtgacgatcaaacaaattctagagtccaaacaggatattcaggacggccccttcgtt
tcgcataaccaagaacttcatcacgtttgttttgtaggtgtggtgagaaacattacagac
catactgcaaatatttttttaactattgaggatggaactggtcaaatagaagtgagaaaa
tggagcgaagatgcaaatgacttggctgccggtaacgatgactcttctggtaaaggttat
ggttcgcaagtcgcccaacaatttgaaattggcggttacgtaaaagtttttggtgctttg
aaagagtttggtggtaagaaaaatatacagtatgcggtgattaagcccatagattcattc
aatgaagtgttgacgcatcacttggaagtcatcaaatgtcattccatagccagtggaatg
atgaaacaacctttggagagtgcatccaacaacaatgggcaatcattatttgtcaaggat
gataacgatacatcttccggctccagtccgttacaaagaattctagaattttgtaagaag
caatgtgagggcaaagacgctaattcattcgctgttcccattccattgatctcgcaatcc
ttgaatttggatgaaactaccgtcagaaactgctgtacgaccttgactgaccagggtttt
atctacccaacttttgatgacaataacttctttgccctatga

DBGET integrated database retrieval system