KEGG   Saccharomyces cerevisiae (budding yeast): YNL335WHelp
Entry
YNL335W           CDS       T00005                                 

Gene name
DDI3
Definition
(RefSeq) cyanamide hydratase (EC:4.2.1.69)
  KO
K06035  
cyanamide hydratase [EC:4.2.1.69]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Atrazine degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    YNL335W (DDI3)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.69  cyanamide hydratase
     YNL335W (DDI3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:11452..12129
Genome map
AA seq 225 aa AA seqDB search
MSQYGFVRVPREVEKAIPVVNAPRPRAVVPPPNSETARLVREYAAKELTAPVLNHSLRVF
QYSVAIIRDQFPAWDLDQEVLYVTCLLHDIATTDKNMRATKMSFEYYGGILSRELVFNAT
GGNQDYADAVTEAIIRHQDLTGTGYITTLGLILQIATTLDNVGSNTDLIHIDTVSAINEQ
FPRLHWLSCFATVVDTENSRKPWGHTSSLGDDFSKKVICNTFGYN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtacggatttgtaagagttcctagagaggtagaaaaggccattccagtggtg
aatgcacctagaccacgggccgttgttccgcctccaaacagtgaaactgctaggcttgtt
cgggaatatgccgctaaagaattgactgcccccgttctaaaccactctttgcgtgttttt
caatatagtgtagctatcataagagaccaatttccagcatgggacttggatcaggaagtt
ttgtacgtcacctgcttacttcatgatattgcaacaacagataagaatatgagagccacg
aagatgtcatttgagtattatggtggcatactttcaagggagcttgtatttaatgcgaca
ggtggaaatcaggactacgcagatgcagtaactgaggccatcattcgtcaccaggatttg
actgggactggctacattaccaccttggggctcattctgcagattgctactacgcttgac
aatgtcggatccaataccgatctgattcatatcgatacagttagtgccattaacgagcaa
tttccaagactgcactggttatcatgttttgctacggtggtggacactgaaaactcgaga
aaaccgtggggccacaccagttctttgggtgatgatttttcaaagaaagtcatatgcaat
acatttgggtataactaa

DBGET integrated database retrieval system