KEGG   Saccharomyces cerevisiae (budding yeast): YNL335WHelp
Entry
YNL335W           CDS       T00005                                 

Gene name
DDI3
Definition
Ddi3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:11452..12129
Genome map
AA seq 225 aa AA seqDB search
MSQYGFVRVPREVEKAIPVVNAPRPRAVVPPPNSETARLVREYAAKELTAPVLNHSLRVF
QYSVAIIRDQFPAWDLDQEVLYVTCLLHDIATTDKNMRATKMSFEYYGGILSRELVFNAT
GGNQDYADAVTEAIIRHQDLTGTGYITTLGLILQIATTLDNVGSNTDLIHIDTVSAINEQ
FPRLHWLSCFATVVDTENSRKPWGHTSSLGDDFSKKVICNTFGYN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtacggatttgtaagagttcctagagaggtagaaaaggccattccagtggtg
aatgcacctagaccacgggccgttgttccgcctccaaacagtgaaactgctaggcttgtt
cgggaatatgccgctaaagaattgactgcccccgttctaaaccactctttgcgtgttttt
caatatagtgtagctatcataagagaccaatttccagcatgggacttggatcaggaagtt
ttgtacgtcacctgcttacttcatgatattgcaacaacagataagaatatgagagccacg
aagatgtcatttgagtattatggtggcatactttcaagggagcttgtatttaatgcgaca
ggtggaaatcaggactacgcagatgcagtaactgaggccatcattcgtcaccaggatttg
actgggactggctacattaccaccttggggctcattctgcagattgctactacgcttgac
aatgtcggatccaataccgatctgattcatatcgatacagttagtgccattaacgagcaa
tttccaagactgcactggttatcatgttttgctacggtggtggacactgaaaactcgaga
aaaccgtggggccacaccagttctttgggtgatgatttttcaaagaaagtcatatgcaat
acatttgggtataactaa

DBGET integrated database retrieval system