KEGG   Saccharomyces cerevisiae (budding yeast): YNR016CHelp
Entry
YNR016C           CDS       T00005                                 

Gene name
ACC1, ABP2, FAS3, MTR7
Definition
acetyl-CoA carboxylase ACC1 (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sce01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sce00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sce00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:sce00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIV:complement(654673..661374)
Genome map
AA seq 2233 aa AA seqDB search
MSEESLFESSPQKMEYEITNYSERHTELPGHFIGLNTVDKLEESPLRDFVKSHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVP
GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAM
RSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQ
KAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLAGRARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVS
AGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISDIRT
LYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHELNF
RSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLITHKMTAEKPDPTLAVICGAATKAFLASEEARHKY
IESLQKGQVLSKDLLQTMFPVDFIHEGKRYKFTVAKSGNDRYTLFINGSKCDIILRQLSD
GGLLIAIGGKSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGE
HIIKGQPYAEIEVMKMQMPLVSQENGIVQLLKQPGSTIVAGDIMAIMTLDDPSKVKHALP
FEGMLPDFGSPVIEGTKPAYKFKSLVSTLENILKGYDNQVIMNASLQQLIEVLRNPKLPY
SEWKLHISALHSRLPAKLDEQMEELVARSLRRGAVFPARQLSKLIDMAVKNPEYNPDKLL
GAVVEPLADIAHKYSNGLEAHEHSIFVHFLEEYYEVEKLFNGPNVREENIILKLRDENPK
DLDKVALTVLSHSKVSAKNNLILAILKHYQPLCKLSSKVSAIFSTPLQHIVELESKATAK
VALQAREILIQGALPSVKERTEQIEHILKSSVVKVAYGSSNPKRSEPDLNILKDLIDSNY
VVFDVLLQFLTHQDPVVTAAAAQVYIRRAYRAYTIGDIRVHEGVTVPIVEWKFQLPSAAF
STFPTVKSKMGMNRAVSVSDLSYVANSQSSPLREGILMAVDHLDDVDEILSQSLEVIPRH
QSSSNGPAPDRSGSSASLSNVANVCVASTEGFESEEEILVRLREILDLNKQELINASIRR
ITFMFGFKDGSYPKYYTFNGPNYNENETIRHIEPALAFQLELGRLSNFNIKPIFTDNRNI
HVYEAVSKTSPLDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEVTDTSNS
DLNHIFINFIAVFDISPEDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIKDPQTGAPVPL
RALINNVSGYVIKTEMYTEVKNAKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKA
HLMGTTYVYDFPELFRQASSSQWKNFSADVKLTDDFFISNELIEDENGELTEVEREPGAN
AIGMVAFKITVKTPEYPRGRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIY
LAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERT
VINGEERFVIKTIIGSEDGLGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLV
RLGQRAIQVEGQPIILTGAPAINKMLGREVYTSNLQLGGTQIMYNNGVSHLTAVDDLAGV
EKIVEWMSYVPAKRNMPVPILETKDTWDRPVDFTPTNDETYDVRWMIEGRETESGFEYGL
FDKGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETRTVENLIPADPANPNSAETLIQEP
GQVWHPNSAFKTAQAINDFNNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVD
YKQPIIIYIPPTGELRGGSWVVVDPTINADQMEMYADVNARAGVLEPQGMVGIKFRREKL
LDTMNRLDDKYRELRSQLSNKSLAPEVHQQISKQLADRERELLPIYGQISLQFADLHDRS
SRMVAKGVISKELEWTEARRFFFWRLRRRLNEEYLIKRLSHQVGEASRLEKIARIRSWYP
ASVDHEDDRQVATWIEENYKTLDDKLKGLKLESFAQDLAKKIRSDHDNAIDGLSEVIKML
STDDKEKLLKTLK
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaagcttattcgagtcttctccacagaagatggagtacgaaattacaaac
tactcagaaagacatacagaacttccaggtcatttcattggcctcaatacagtagataaa
ctagaggagtccccgttaagggactttgttaagagtcacggtggtcacacggtcatatcc
aagatcctgatagcaaataatggtattgccgccgtgaaagaaattagatccgtcagaaaa
tgggcatacgagacgttcggcgatgacagaaccgtccaattcgtcgccatggccacccca
gaagatctggaggccaacgcagaatatatccgtatggccgatcaatacattgaagtgcca
ggtggtactaataataacaactacgctaacgtagacttgatcgtagacatcgccgaaaga
gcagacgtagacgccgtatgggctggctggggtcacgcctccgagaatccactattgcct
gaaaaattgtcccagtctaagaggaaagtcatctttattgggcctccaggtaacgccatg
aggtctttaggtgataaaatctcctctaccattgtcgctcaaagtgctaaagtcccatgt
attccatggtctggtaccggtgttgacaccgttcacgtggacgagaaaaccggtctggtc
tctgtcgacgatgacatctatcaaaagggttgttgtacctctcctgaagatggtttacaa
aaggccaagcgtattggttttcctgtcatgattaaggcatccgaaggtggtggtggtaaa
ggtatcagacaagttgaacgtgaagaagatttcatcgctttataccaccaggcagccaac
gaaattccaggctcccccattttcatcatgaagttggccggtagagcgcgtcacttggaa
gttcaactgctagcagatcagtacggtacaaatatttccttgttcggtagagactgttcc
gttcagagacgtcatcaaaaaattatcgaagaagcaccagttacaattgccaaggctgaa
acatttcacgagatggaaaaggctgccgtcagactggggaaactagtcggttatgtctct
gccggtaccgtggagtatctatattctcatgatgatggaaaattctactttttagaattg
aacccaagattacaagtcgagcatccaacaacggaaatggtctccggtgttaacttacct
gcagctcaattacaaatcgctatgggtatccctatgcatagaataagtgacattagaact
ttatatggtatgaatcctcattctgcctcagaaatcgatttcgaattcaaaactcaagat
gccaccaagaaacaaagaagacctattccaaagggtcattgtaccgcttgtcgtatcaca
tcagaagatccaaacgatggattcaagccatcgggtggtactttgcatgaactaaacttc
cgttcttcctctaatgtttggggttacttctccgtgggtaacaatggtaatattcactcc
ttttcggactctcagttcggccatatttttgcttttggtgaaaatagacaagcttccagg
aaacacatggttgttgccctgaaggaattgtccattaggggtgatttcagaactactgtg
gaatacttgatcaaacttttggaaactgaagatttcgaggataacactattaccaccggt
tggttggacgatttgattactcataaaatgaccgctgaaaagcctgatccaactcttgcc
gtcatttgcggtgccgctacaaaggctttcttagcatctgaagaagcccgccacaagtat
atcgaatccttacaaaagggacaagttctatctaaagacctactgcaaactatgttccct
gtagattttatccatgagggtaaaagatacaagttcaccgtagctaaatccggtaatgac
cgttacacattatttatcaatggttctaaatgtgatatcatactgcgtcaactatctgat
ggtggtcttttgattgccataggcggtaaatcgcataccatctattggaaagaagaagtt
gctgctacaagattatccgttgactctatgactactttgttggaagttgaaaacgatcca
acccagttgcgtactccatcccctggtaaattggttaaattcttggtggaaaatggtgaa
cacattatcaagggccaaccatatgcagaaattgaagttatgaaaatgcaaatgcctttg
gtttctcaagaaaatggtatcgtccagttattaaagcaacctggttctaccattgttgca
ggtgatatcatggctattatgactcttgacgatccatccaaggtcaagcacgctctacca
tttgaaggtatgctgccagattttggttctccagttatcgaaggaaccaaacctgcctat
aaattcaagtcattagtgtctactttggaaaacattttgaagggttatgacaaccaagtt
attatgaacgcttccttgcaacaattgatagaggttttgagaaatccaaaactgccttac
tcagaatggaaactacacatctctgctttacattcaagattgcctgctaagctagatgaa
caaatggaagagttagttgcacgttctttgagacgtggtgctgttttcccagctagacaa
ttaagtaaattgattgatatggccgtgaagaatcctgaatacaaccccgacaaattgctg
ggcgccgtcgtggaaccattggcggatattgctcataagtactctaacgggttagaagcc
catgaacattctatatttgtccatttcttggaagaatattacgaagttgaaaagttattc
aatggtccaaatgttcgtgaggaaaatatcattctgaaattgcgtgatgaaaaccctaaa
gatctagataaagttgcgctaactgttttgtctcattcgaaagtttcagcgaagaataac
ctgatcctagctatcttgaaacattatcaaccattgtgcaagttatcttctaaagtttct
gccattttctctactcctctacaacatattgttgaactagaatctaaggctaccgctaag
gtcgctctacaagcaagagaaattttgattcaaggcgctttaccttcggtcaaggaaaga
actgaacaaattgaacatatcttaaaatcctctgttgtgaaggttgcctatggctcatcc
aatccaaagcgctctgaaccagatttgaatatcttgaaggacttgatcgattctaattac
gttgtgttcgatgttttacttcaattcctaacccatcaagacccagttgtgactgctgca
gctgctcaagtctatattcgtcgtgcttatcgtgcttacaccataggagatattagagtt
cacgaaggtgtcacagttccaattgttgaatggaaattccaactaccttcagctgcgttc
tccacctttccaactgttaaatctaaaatgggtatgaacagggctgtttctgtttcagat
ttgtcatatgttgcaaacagtcagtcatctccgttaagagaaggtattttgatggctgtg
gatcatttagatgatgttgatgaaattttgtcacaaagtttggaagttattcctcgtcac
caatcttcttctaacggacctgctcctgatcgttctggtagctccgcatcgttgagtaat
gttgctaatgtttgtgttgcttctacagaaggtttcgaatctgaagaggaaattttggta
aggttgagagaaattttggatttgaataagcaggaattaatcaatgcttctatccgtcgt
atcacatttatgttcggttttaaagatgggtcttatccaaagtattatacttttaacggt
ccaaattataacgaaaatgaaacaattcgtcacattgagccggctttggccttccaactg
gaattaggaagattgtccaacttcaacattaaaccaattttcactgataatagaaacatc
catgtctacgaagctgttagtaagacttctccattggataagagattctttacaagaggt
attattagaacgggtcatatccgtgatgacatttctattcaagaatatctgacttctgaa
gctaacagattgatgagtgatatattggataatttagaagtcaccgacacttcaaattct
gatttgaatcatatcttcatcaacttcattgcggtgtttgatatctctccagaagatgtc
gaagccgccttcggtggtttcttagaaagatttggtaagagattgttgagattgcgtgtt
tcttctgccgaaattagaatcatcatcaaagatcctcaaacaggtgccccagtaccattg
cgtgccttgatcaataacgtttctggttatgttatcaaaacagaaatgtacaccgaagtc
aagaacgcaaaaggtgaatgggtatttaagtctttgggtaaacctggatccatgcattta
agacctattgctactccttaccctgttaaggaatggttgcaaccaaaacgttataaggca
cacttgatgggtaccacatatgtctatgacttcccagaattattccgccaagcatcgtca
tcccaatggaaaaatttctctgcagatgttaagttaacagatgatttctttatttccaac
gagttgattgaagatgaaaacggcgaattaactgaggtggaaagagaacctggtgccaac
gctattggtatggttgcctttaagattactgtaaagactcctgaatatccaagaggccgt
caatttgttgttgttgctaacgatatcacattcaagatcggttcctttggtccacaagaa
gacgaattcttcaataaggttactgaatatgctagaaagcgtggtatcccaagaatttac
ttggctgcaaactcaggtgccagaattggtatggctgaagagattgttccactatttcaa
gttgcatggaatgatgctgccaatccggacaagggcttccaatacttatacttaacaagt
gaaggtatggaaactttaaagaaatttgacaaagaaaattctgttctcactgaacgtact
gttataaacggtgaagaaagatttgtcatcaagacaattattggttctgaagatgggtta
ggtgtcgaatgtctacgtggatctggtttaattgctggtgcaacgtcaagggcttaccac
gatatcttcactatcaccttagtcacttgtagatccgtcggtatcggtgcttatttggtt
cgtttgggtcaaagagctattcaggtcgaaggccagccaattattttaactggtgctcct
gcaatcaacaaaatgctgggtagagaagtttatacttctaacttacaattgggtggtact
caaatcatgtataacaacggtgtttcacatttgactgctgttgacgatttagctggtgta
gagaagattgttgaatggatgtcttatgttccagccaagcgtaatatgccagttcctatc
ttggaaactaaagacacatgggatagaccagttgatttcactccaactaatgatgaaact
tacgatgtaagatggatgattgaaggtcgtgagactgaaagtggatttgaatatggtttg
tttgataaagggtctttctttgaaactttgtcaggatgggccaaaggtgttgtcgttggt
agagcccgtcttggtggtattccactgggtgttattggtgttgaaacaagaactgtcgag
aacttgattcctgctgatccagctaatccaaatagtgctgaaacattaattcaagaacct
ggtcaagtttggcatccaaactccgccttcaagactgctcaagctatcaatgactttaac
aacggtgaacaattgccaatgatgattttggccaactggagaggtttctctggtggtcaa
cgtgatatgttcaacgaagtcttgaagtatggttcgtttattgttgacgcattggtggat
tacaaacaaccaattattatctatatcccacctaccggtgaactaagaggtggttcatgg
gttgttgtcgatccaactatcaacgctgaccaaatggaaatgtatgccgacgtcaacgct
agagctggtgttttggaaccacaaggtatggttggtatcaagttccgtagagaaaaattg
ctggacaccatgaacagattggatgacaagtacagagaattgagatctcaattatccaac
aagagtttggctccagaagtacatcagcaaatatccaagcaattagctgatcgtgagaga
gaactattgccaatttacggacaaatcagtcttcaatttgctgatttgcacgataggtct
tcacgtatggtggccaagggtgttatttctaaggaactggaatggaccgaggcacgtcgt
ttcttcttctggagattgagaagaagattgaacgaagaatatttgattaaaaggttgagc
catcaggtaggcgaagcatcaagattagaaaagatcgcaagaattagatcgtggtaccct
gcttcagtggaccatgaagatgataggcaagtcgcaacatggattgaagaaaactacaaa
actttggacgataaactaaagggtttgaaattagagtcattcgctcaagacttagctaaa
aagatcagaagcgaccatgacaatgctattgatggattatctgaagttatcaagatgtta
tctaccgatgataaagaaaaattgttgaagactttgaaataa

DBGET integrated database retrieval system