KEGG   Saccharomyces cerevisiae (budding yeast): YNR016CHelp
Entry
YNR016C           CDS       T00005                                 

Gene name
ACC1, ABP2, FAS3, MTR7
Definition
acetyl-CoA carboxylase ACC1 (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    YNR016C (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YNR016C (ACC1)
   00640 Propanoate metabolism
    YNR016C (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    YNR016C (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    YNR016C (ACC1)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     YNR016C (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     YNR016C (ACC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIV:complement(654673..661374)
Genome map
AA seq 2233 aa AA seqDB search
MSEESLFESSPQKMEYEITNYSERHTELPGHFIGLNTVDKLEESPLRDFVKSHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVP
GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAM
RSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQ
KAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLAGRARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVS
AGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISDIRT
LYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHELNF
RSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLITHKMTAEKPDPTLAVICGAATKAFLASEEARHKY
IESLQKGQVLSKDLLQTMFPVDFIHEGKRYKFTVAKSGNDRYTLFINGSKCDIILRQLSD
GGLLIAIGGKSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGE
HIIKGQPYAEIEVMKMQMPLVSQENGIVQLLKQPGSTIVAGDIMAIMTLDDPSKVKHALP
FEGMLPDFGSPVIEGTKPAYKFKSLVSTLENILKGYDNQVIMNASLQQLIEVLRNPKLPY
SEWKLHISALHSRLPAKLDEQMEELVARSLRRGAVFPARQLSKLIDMAVKNPEYNPDKLL
GAVVEPLADIAHKYSNGLEAHEHSIFVHFLEEYYEVEKLFNGPNVREENIILKLRDENPK
DLDKVALTVLSHSKVSAKNNLILAILKHYQPLCKLSSKVSAIFSTPLQHIVELESKATAK
VALQAREILIQGALPSVKERTEQIEHILKSSVVKVAYGSSNPKRSEPDLNILKDLIDSNY
VVFDVLLQFLTHQDPVVTAAAAQVYIRRAYRAYTIGDIRVHEGVTVPIVEWKFQLPSAAF
STFPTVKSKMGMNRAVSVSDLSYVANSQSSPLREGILMAVDHLDDVDEILSQSLEVIPRH
QSSSNGPAPDRSGSSASLSNVANVCVASTEGFESEEEILVRLREILDLNKQELINASIRR
ITFMFGFKDGSYPKYYTFNGPNYNENETIRHIEPALAFQLELGRLSNFNIKPIFTDNRNI
HVYEAVSKTSPLDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEVTDTSNS
DLNHIFINFIAVFDISPEDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIKDPQTGAPVPL
RALINNVSGYVIKTEMYTEVKNAKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKA
HLMGTTYVYDFPELFRQASSSQWKNFSADVKLTDDFFISNELIEDENGELTEVEREPGAN
AIGMVAFKITVKTPEYPRGRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIY
LAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERT
VINGEERFVIKTIIGSEDGLGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLV
RLGQRAIQVEGQPIILTGAPAINKMLGREVYTSNLQLGGTQIMYNNGVSHLTAVDDLAGV
EKIVEWMSYVPAKRNMPVPILETKDTWDRPVDFTPTNDETYDVRWMIEGRETESGFEYGL
FDKGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETRTVENLIPADPANPNSAETLIQEP
GQVWHPNSAFKTAQAINDFNNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVD
YKQPIIIYIPPTGELRGGSWVVVDPTINADQMEMYADVNARAGVLEPQGMVGIKFRREKL
LDTMNRLDDKYRELRSQLSNKSLAPEVHQQISKQLADRERELLPIYGQISLQFADLHDRS
SRMVAKGVISKELEWTEARRFFFWRLRRRLNEEYLIKRLSHQVGEASRLEKIARIRSWYP
ASVDHEDDRQVATWIEENYKTLDDKLKGLKLESFAQDLAKKIRSDHDNAIDGLSEVIKML
STDDKEKLLKTLK
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaagcttattcgagtcttctccacagaagatggagtacgaaattacaaac
tactcagaaagacatacagaacttccaggtcatttcattggcctcaatacagtagataaa
ctagaggagtccccgttaagggactttgttaagagtcacggtggtcacacggtcatatcc
aagatcctgatagcaaataatggtattgccgccgtgaaagaaattagatccgtcagaaaa
tgggcatacgagacgttcggcgatgacagaaccgtccaattcgtcgccatggccacccca
gaagatctggaggccaacgcagaatatatccgtatggccgatcaatacattgaagtgcca
ggtggtactaataataacaactacgctaacgtagacttgatcgtagacatcgccgaaaga
gcagacgtagacgccgtatgggctggctggggtcacgcctccgagaatccactattgcct
gaaaaattgtcccagtctaagaggaaagtcatctttattgggcctccaggtaacgccatg
aggtctttaggtgataaaatctcctctaccattgtcgctcaaagtgctaaagtcccatgt
attccatggtctggtaccggtgttgacaccgttcacgtggacgagaaaaccggtctggtc
tctgtcgacgatgacatctatcaaaagggttgttgtacctctcctgaagatggtttacaa
aaggccaagcgtattggttttcctgtcatgattaaggcatccgaaggtggtggtggtaaa
ggtatcagacaagttgaacgtgaagaagatttcatcgctttataccaccaggcagccaac
gaaattccaggctcccccattttcatcatgaagttggccggtagagcgcgtcacttggaa
gttcaactgctagcagatcagtacggtacaaatatttccttgttcggtagagactgttcc
gttcagagacgtcatcaaaaaattatcgaagaagcaccagttacaattgccaaggctgaa
acatttcacgagatggaaaaggctgccgtcagactggggaaactagtcggttatgtctct
gccggtaccgtggagtatctatattctcatgatgatggaaaattctactttttagaattg
aacccaagattacaagtcgagcatccaacaacggaaatggtctccggtgttaacttacct
gcagctcaattacaaatcgctatgggtatccctatgcatagaataagtgacattagaact
ttatatggtatgaatcctcattctgcctcagaaatcgatttcgaattcaaaactcaagat
gccaccaagaaacaaagaagacctattccaaagggtcattgtaccgcttgtcgtatcaca
tcagaagatccaaacgatggattcaagccatcgggtggtactttgcatgaactaaacttc
cgttcttcctctaatgtttggggttacttctccgtgggtaacaatggtaatattcactcc
ttttcggactctcagttcggccatatttttgcttttggtgaaaatagacaagcttccagg
aaacacatggttgttgccctgaaggaattgtccattaggggtgatttcagaactactgtg
gaatacttgatcaaacttttggaaactgaagatttcgaggataacactattaccaccggt
tggttggacgatttgattactcataaaatgaccgctgaaaagcctgatccaactcttgcc
gtcatttgcggtgccgctacaaaggctttcttagcatctgaagaagcccgccacaagtat
atcgaatccttacaaaagggacaagttctatctaaagacctactgcaaactatgttccct
gtagattttatccatgagggtaaaagatacaagttcaccgtagctaaatccggtaatgac
cgttacacattatttatcaatggttctaaatgtgatatcatactgcgtcaactatctgat
ggtggtcttttgattgccataggcggtaaatcgcataccatctattggaaagaagaagtt
gctgctacaagattatccgttgactctatgactactttgttggaagttgaaaacgatcca
acccagttgcgtactccatcccctggtaaattggttaaattcttggtggaaaatggtgaa
cacattatcaagggccaaccatatgcagaaattgaagttatgaaaatgcaaatgcctttg
gtttctcaagaaaatggtatcgtccagttattaaagcaacctggttctaccattgttgca
ggtgatatcatggctattatgactcttgacgatccatccaaggtcaagcacgctctacca
tttgaaggtatgctgccagattttggttctccagttatcgaaggaaccaaacctgcctat
aaattcaagtcattagtgtctactttggaaaacattttgaagggttatgacaaccaagtt
attatgaacgcttccttgcaacaattgatagaggttttgagaaatccaaaactgccttac
tcagaatggaaactacacatctctgctttacattcaagattgcctgctaagctagatgaa
caaatggaagagttagttgcacgttctttgagacgtggtgctgttttcccagctagacaa
ttaagtaaattgattgatatggccgtgaagaatcctgaatacaaccccgacaaattgctg
ggcgccgtcgtggaaccattggcggatattgctcataagtactctaacgggttagaagcc
catgaacattctatatttgtccatttcttggaagaatattacgaagttgaaaagttattc
aatggtccaaatgttcgtgaggaaaatatcattctgaaattgcgtgatgaaaaccctaaa
gatctagataaagttgcgctaactgttttgtctcattcgaaagtttcagcgaagaataac
ctgatcctagctatcttgaaacattatcaaccattgtgcaagttatcttctaaagtttct
gccattttctctactcctctacaacatattgttgaactagaatctaaggctaccgctaag
gtcgctctacaagcaagagaaattttgattcaaggcgctttaccttcggtcaaggaaaga
actgaacaaattgaacatatcttaaaatcctctgttgtgaaggttgcctatggctcatcc
aatccaaagcgctctgaaccagatttgaatatcttgaaggacttgatcgattctaattac
gttgtgttcgatgttttacttcaattcctaacccatcaagacccagttgtgactgctgca
gctgctcaagtctatattcgtcgtgcttatcgtgcttacaccataggagatattagagtt
cacgaaggtgtcacagttccaattgttgaatggaaattccaactaccttcagctgcgttc
tccacctttccaactgttaaatctaaaatgggtatgaacagggctgtttctgtttcagat
ttgtcatatgttgcaaacagtcagtcatctccgttaagagaaggtattttgatggctgtg
gatcatttagatgatgttgatgaaattttgtcacaaagtttggaagttattcctcgtcac
caatcttcttctaacggacctgctcctgatcgttctggtagctccgcatcgttgagtaat
gttgctaatgtttgtgttgcttctacagaaggtttcgaatctgaagaggaaattttggta
aggttgagagaaattttggatttgaataagcaggaattaatcaatgcttctatccgtcgt
atcacatttatgttcggttttaaagatgggtcttatccaaagtattatacttttaacggt
ccaaattataacgaaaatgaaacaattcgtcacattgagccggctttggccttccaactg
gaattaggaagattgtccaacttcaacattaaaccaattttcactgataatagaaacatc
catgtctacgaagctgttagtaagacttctccattggataagagattctttacaagaggt
attattagaacgggtcatatccgtgatgacatttctattcaagaatatctgacttctgaa
gctaacagattgatgagtgatatattggataatttagaagtcaccgacacttcaaattct
gatttgaatcatatcttcatcaacttcattgcggtgtttgatatctctccagaagatgtc
gaagccgccttcggtggtttcttagaaagatttggtaagagattgttgagattgcgtgtt
tcttctgccgaaattagaatcatcatcaaagatcctcaaacaggtgccccagtaccattg
cgtgccttgatcaataacgtttctggttatgttatcaaaacagaaatgtacaccgaagtc
aagaacgcaaaaggtgaatgggtatttaagtctttgggtaaacctggatccatgcattta
agacctattgctactccttaccctgttaaggaatggttgcaaccaaaacgttataaggca
cacttgatgggtaccacatatgtctatgacttcccagaattattccgccaagcatcgtca
tcccaatggaaaaatttctctgcagatgttaagttaacagatgatttctttatttccaac
gagttgattgaagatgaaaacggcgaattaactgaggtggaaagagaacctggtgccaac
gctattggtatggttgcctttaagattactgtaaagactcctgaatatccaagaggccgt
caatttgttgttgttgctaacgatatcacattcaagatcggttcctttggtccacaagaa
gacgaattcttcaataaggttactgaatatgctagaaagcgtggtatcccaagaatttac
ttggctgcaaactcaggtgccagaattggtatggctgaagagattgttccactatttcaa
gttgcatggaatgatgctgccaatccggacaagggcttccaatacttatacttaacaagt
gaaggtatggaaactttaaagaaatttgacaaagaaaattctgttctcactgaacgtact
gttataaacggtgaagaaagatttgtcatcaagacaattattggttctgaagatgggtta
ggtgtcgaatgtctacgtggatctggtttaattgctggtgcaacgtcaagggcttaccac
gatatcttcactatcaccttagtcacttgtagatccgtcggtatcggtgcttatttggtt
cgtttgggtcaaagagctattcaggtcgaaggccagccaattattttaactggtgctcct
gcaatcaacaaaatgctgggtagagaagtttatacttctaacttacaattgggtggtact
caaatcatgtataacaacggtgtttcacatttgactgctgttgacgatttagctggtgta
gagaagattgttgaatggatgtcttatgttccagccaagcgtaatatgccagttcctatc
ttggaaactaaagacacatgggatagaccagttgatttcactccaactaatgatgaaact
tacgatgtaagatggatgattgaaggtcgtgagactgaaagtggatttgaatatggtttg
tttgataaagggtctttctttgaaactttgtcaggatgggccaaaggtgttgtcgttggt
agagcccgtcttggtggtattccactgggtgttattggtgttgaaacaagaactgtcgag
aacttgattcctgctgatccagctaatccaaatagtgctgaaacattaattcaagaacct
ggtcaagtttggcatccaaactccgccttcaagactgctcaagctatcaatgactttaac
aacggtgaacaattgccaatgatgattttggccaactggagaggtttctctggtggtcaa
cgtgatatgttcaacgaagtcttgaagtatggttcgtttattgttgacgcattggtggat
tacaaacaaccaattattatctatatcccacctaccggtgaactaagaggtggttcatgg
gttgttgtcgatccaactatcaacgctgaccaaatggaaatgtatgccgacgtcaacgct
agagctggtgttttggaaccacaaggtatggttggtatcaagttccgtagagaaaaattg
ctggacaccatgaacagattggatgacaagtacagagaattgagatctcaattatccaac
aagagtttggctccagaagtacatcagcaaatatccaagcaattagctgatcgtgagaga
gaactattgccaatttacggacaaatcagtcttcaatttgctgatttgcacgataggtct
tcacgtatggtggccaagggtgttatttctaaggaactggaatggaccgaggcacgtcgt
ttcttcttctggagattgagaagaagattgaacgaagaatatttgattaaaaggttgagc
catcaggtaggcgaagcatcaagattagaaaagatcgcaagaattagatcgtggtaccct
gcttcagtggaccatgaagatgataggcaagtcgcaacatggattgaagaaaactacaaa
actttggacgataaactaaagggtttgaaattagagtcattcgctcaagacttagctaaa
aagatcagaagcgaccatgacaatgctattgatggattatctgaagttatcaagatgtta
tctaccgatgataaagaaaaattgttgaagactttgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system