KEGG   Saccharomyces cerevisiae (budding yeast): YNR051CHelp
Entry
YNR051C           CDS       T00005                                 

Gene name
BRE5
Definition
(RefSeq) Bre5p
  KO
K19718  
UBP3-associated protein BRE5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    YNR051C (BRE5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
XIV:complement(716780..718327)
Genome map
AA seq 515 aa AA seqDB search
MGVTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYQSKSTNEKDDVLPTVKVT
GRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEMFWTGTPVYKFCQTF
ILLPSSNGSTFDITNDIIRFISNSFKPYVLTDASLSQSNEENSVSAVEEDKIRHESGVEK
EKEKEKSPEISKPKAKKETVKDTTAPTESSTQEKPIVDHSQPRAIPVTKESKIHTETVPS
STKGNHKQDEVSTEELGNVTKLNEKSHKAEKKAAPIKTKEGSVEAINAVNNSSLPNGKEV
SDEKPVPGGVKEAETEIKPIEPQVSDAKESGNNASTPSSSPEPVANPPKMTWASKLMNEN
SDRISKNNTTVEYIRPETLPKKPTERKFEMGNRRDNASANSKNKKKPVFSTVNKDGFYPI
YIRGTNGLREEKLRSALEKEFGKVMRITAADNFAVVDFETQKSQIDALEKKKKSIDGIEV
CLERKTVKKPTSNNPPGIFTNGTRSHRKQPLKRKD
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttaccgttcaagacatatgttttgcctttttgcaaaactactacgaaagaatg
aggaccgacccttccaaattggcatatttttatgcaagtacagccgagttgacgcatact
aattatcagtccaagtcaacaaacgaaaaagatgacgttcttccaacggtgaaagttact
ggacgtgaaaacattaataagtttttttctagaaatgatgccaaagttaggagcttgaaa
ctaaaattagatactatagatttccagtacactgggcacttgcacaaaagcattctgatc
atggccacgggtgaaatgttttggacaggaactccggtctataagttttgtcaaacattt
atcctgctaccatccagcaatgggtctacgtttgacattaccaatgatataatcagattt
atttccaattcattcaagccttatgtcttaacagatgcttctttgtcacaatctaacgag
gagaactctgtcagtgcagttgaagaagataaaataaggcatgagtccggagttgaaaaa
gaaaaagaaaaagaaaaatcaccagaaatatcgaaaccaaaggccaaaaaggaaacggtc
aaagacacaactgcgccaactgaatcgtcaactcaggaaaaaccaattgtcgatcatagt
caacctcgggctatacccgtcactaaagagtccaagattcacaccgaaacggtaccatct
agtactaagggcaaccacaaacaagatgaggtctctacagaagagttaggaaacgttact
aaactaaatgaaaaatctcacaaagccgaaaagaaagctgcaccaatcaagacaaaggaa
ggctctgttgaggccataaatgctgttaataactcttctttgcccaacggtaaagaagtt
agtgatgaaaaaccggtacctgggggcgtaaaggaagctgaaactgaaattaaaccaata
gagccacaggtttccgacgccaaagaatccggcaataacgcttcaacaccttcatcttct
ccagagcccgttgcgaatccaccaaagatgacatgggcctcaaagttgatgaatgaaaac
tccgacagaattagcaaaaataataccacggttgaatacatcagacctgaaacactaccc
aagaaaccgactgaaagaaaatttgaaatggggaatcggagggacaacgctagtgctaac
agcaaaaataagaaaaaaccagtattcagcaccgttaacaaggacggcttttatccaatc
tacattagaggtacaaatggcttaagagaagaaaaattgagaagtgccttagaaaaagaa
ttcggtaaagttatgaggataacagctgcagacaattttgccgtcgtcgactttgaaact
caaaagagccaaatcgatgctttagagaagaagaaaaagtcaattgatggtattgaagta
tgcttagaaagaaaaacagtaaagaagcccacgagcaataatcctcctggcatatttact
aatggaacacgttctcatagaaagcaacccctaaaaagaaaggactag

DBGET integrated database retrieval system