KEGG   Saccharomyces cerevisiae (budding yeast): YOL001WHelp
Entry
YOL001W           CDS       T00005                                 

Gene name
PHO80, AGS3, TUP7, VAC5
Definition
Pho80p
Orthology
K06654  
phosphate system cyclin PHO80
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOL001W (PHO80)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Fungal regulators
    YOL001W (PHO80)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:325249..326130
Genome map
AA seq 293 aa AA seqDB search
MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD
QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH
RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK
VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcacatcaggagaacgttccgaaaatatacatgaggatcaagggataccaaaa
gtaattctgcccgctgattttaataaatgctctagaactgacctagtggtgctcatatca
cgaatgttagtatcgctgatagcaatcaatgaaaattcagcaacaaagaaatctgatgac
caaattactttaacacgataccattctaagattcctccaaacatatcaatcttcaactat
ttcatacgactgacaaagttttcctctttagaacattgtgtgcttatgacatcactctat
tatatcgatttattgcaaactgtgtatcctgattttacgcttaattcgttgactgcccat
aggtttttattaacagccaccacagtcgcaacaaaaggcttatgtgattcgttctcaaca
aacgcccattatgcaaaagttggaggagtacgatgtcacgaattgaatatactggagaac
gattttttaaagagagtaaactacagaatcattccgcgggatcataacattacgttatgt
agtatagagcaaaaacagaaaaagtttgtcatagataaaaacgcattagggtctctcgat
ttggattcttattcttacgttaatcgtccaaaaagtggatataatgttctagataaatac
tatcgaagaatagttcagctggtgggttcctttaacgcttcacctgataagagtagaaag
gttgattatgttctcccgccaaatattgatatagtgagtgaaagtggctcccaaactact
caactaaaggggtcgtcatcacccaattctcactcttcacaaaagcgatattctgaggca
aaggacgcacatatctataacaagcgatcaaagccagattaa

DBGET integrated database retrieval system