KEGG   Saccharomyces cerevisiae (budding yeast): YOL011WHelp
Entry
YOL011W           CDS       T00005                                 

Gene name
PLB3
Definition
Plb3p (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sce00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:305349..307409
Genome map
AA seq 686 aa AA seqDB search
MIRPLCSKIIISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAW
LEKRNKVTSVALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTG
AGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQND
DSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSL
NRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPS
LNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFIT
RLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVL
PLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNL
GLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGF
EIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVE
KDVHHSFINVNSFNSSIGQEESLYAGSSASQSSSSSSSSSSSSEIPSATATLEKKAATNS
GSHLSGISVKFSAMIMLTLLMFTGAV
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtccattatgttcaaaaattattatcagttacatattcgcaatttctcagttt
ctactggccgctaatgcgtggtcgcccacagatagttatgttcctggcaccgtgtcgtgt
cccgatgacataaatctggtaagagaggctacgtctatatctcagaatgagagcgcatgg
ttggaaaagaggaataaagtcactagtgtagctttaaaagatttcttgactagggctact
gcaaatttttcagatagctcagaagttttgtcgaagctatttaatgatggcaacagcgaa
aacctgccgaaaattgctgtcgccgtttcaggtgggggctatcggtccatgctaacaggt
gcgggtgttctagcagcaatggataacagaactgaaggtgcttatgagcatgggctgggt
ggacttttacaaagcacaacatatttatctggtgcctcgggcggcaactggctagttggt
acattagccttgaacaattggacatccgtgcaagacattcttaataatatgcagaacgac
gattctatttgggatttgtcagattctattgttacccccggcggcattaatatattcaaa
acagccaaaaggtgggatcatatctctaatgctgtcgaatctaagcagaacgccgattac
aatacttctttggccgatatttggggcagagccttggcgtataattttttcccttctcta
aatagagggggtataggcctgacttggtcttccattagggatttcccagtgtttcaaaat
gctgaaatgccttttccaatttctgttgcggacggtaggtatcctggaacaaaagtcatc
aatttgaacgcaacggtttttgaatttaatccctttgaaatgggatcctgggatccctct
ttgaactcttttgccaacgttaagtaccttggaacgaatgtctccaatggtgtaccattg
gaaaggggaaaatgtaccgcaggctttgataatgcaggttttatcatgggtacttcctcc
accttatttaaccagtttcttttgagaataaactccactcacttacctagtttcatcaca
agattagcaagacattttctaaaggatttatctcaagattttaatgatatcgctgtttac
agtcctaatccatttaaagacacgaagtttttggatagtgactatacgacaagtattgtt
gattcagacagcctattcttagttgacggcggtgaagacgacgaaaatgttcctgtgtta
ccgcttatacaaaaggaacgtgatgtggacattatttttgcggtagataattctgccgat
atgagattggcttggcctgacggttcttctttagtccatacctatgagcgtcaattcgtt
aagcaaggtcaaggtatgtccttcccatatgttccagatacgaatacattcgttaatttg
ggtttgaacaagaaaccaaccttcttcggttgcgatgctaataatttgaccgatcttcaa
tatattccacctctagttgtttatctgccaaatgcagaatactctttcaatagtaatcag
agcgcgttcaagctatcatattccgaatcccaaagaagaagtatgattcaaaacgggttt
gaaattgcaactaggaacaacttcactgatgatcctgaattcatgggctgcgtcggctgc
gccatcattagacgtaagcaacaagctttgaatattactttgcctccggaatgtgaaacc
tgttttaaaaattattgctggaatggtaccctggatactaccccattaccagatgttgaa
aaggatgttcaccactcctttatcaacgtcaatagcttcaacagctccataggacaagaa
gaaagtctttacgccggatcttcagcttcccagtcatcgtcttcatcatcgtcttcatct
tcgtcttcggaaattccttcggctactgcaacccttgagaaaaaggcagctactaattct
ggatcacatttatctggcataagtgtaaagttctctgctatgattatgcttactttattg
atgtttaccggagcagtataa

DBGET integrated database retrieval system