KEGG   Saccharomyces cerevisiae (budding yeast): YOL056WHelp
Entry
YOL056W           CDS       T00005                                 

Gene name
GPM3
Definition
phosphoglycerate mutase family protein GPM3 (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:sce00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sce00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:223268..224179
Genome map
AA seq 303 aa AA seqDB search
MTVTDTFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNISLP
QIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNE
RHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDFKE
PNRHLKYGPEEKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVR
SLLKVLEGISDEDIKDVDIPNGIPLVIELDRDNYSFVRKFYLDPESAKVNAQMVRDEGFE
KNP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactgttactgacacttttaaactgtttattttaaggcatggtcaaagtgaattaaac
tcagaaaacatattctgcggatggattgatgctcaattaacggaaaaagggaagtctcag
gcccgccactctgcaaaattgatcaagcagttttgcgattctaacaatatctctttgcct
cagattggctatacttcaaggttgattcgaactcagcagaccatggacgttattctcgaa
gagttgggactaaaacacaccaattatgtaattactacgaatacaaacattaaggaggag
ctgcaggacacaagatttgaaggaagtatgcctgtgttgcaaacctggaggttaaatgag
cgtcattacggcgcatggcaaggacaaagaaagccagatatcttgaaagaatacggtaag
gaaaaatacatgtatatcagaagagattacaacggaaaaccccctaaagtcaacctaaac
ctggaaatggtccaagaggaaaatgatcaggggtcctccacaggctatgattttaaggag
cccaatagacacttaaaatacggccccgaagagaaggctaatgagcgtctgccagaaagt
gagtctctttgtgaagtggtcgtcagattgaaaccatttttaaataatgttgttctgtct
accgccaacaaaatcagtcaagaatcgtgtgttatagttgggcatggcagctctgtaaga
tctctgctgaaagtattggaaggtatctcagatgaagacatcaaagatgtcgatattccc
aacggcattccgctagttatagagttggatagagacaattactcttttgtgaggaaattt
tacttggatccagaatcagctaaagttaatgctcaaatggttcgtgatgagggtttcgaa
aagaatccatga

DBGET integrated database retrieval system