KEGG   Saccharomyces cerevisiae (budding yeast): YOL056WHelp
Entry
YOL056W           CDS       T00005                                 

Gene name
GPM3
Definition
phosphoglycerate mutase family protein GPM3 (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YOL056W (GPM3)
   01230 Biosynthesis of amino acids
    YOL056W (GPM3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YOL056W (GPM3)
  Energy metabolism
   00680 Methane metabolism
    YOL056W (GPM3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YOL056W (GPM3)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YOL056W (GPM3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YOL056W (GPM3)
  Exosomal proteins of melanoma cells
   YOL056W (GPM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:223268..224179
Genome map
AA seq 303 aa AA seqDB search
MTVTDTFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNISLP
QIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNE
RHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDFKE
PNRHLKYGPEEKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVR
SLLKVLEGISDEDIKDVDIPNGIPLVIELDRDNYSFVRKFYLDPESAKVNAQMVRDEGFE
KNP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactgttactgacacttttaaactgtttattttaaggcatggtcaaagtgaattaaac
tcagaaaacatattctgcggatggattgatgctcaattaacggaaaaagggaagtctcag
gcccgccactctgcaaaattgatcaagcagttttgcgattctaacaatatctctttgcct
cagattggctatacttcaaggttgattcgaactcagcagaccatggacgttattctcgaa
gagttgggactaaaacacaccaattatgtaattactacgaatacaaacattaaggaggag
ctgcaggacacaagatttgaaggaagtatgcctgtgttgcaaacctggaggttaaatgag
cgtcattacggcgcatggcaaggacaaagaaagccagatatcttgaaagaatacggtaag
gaaaaatacatgtatatcagaagagattacaacggaaaaccccctaaagtcaacctaaac
ctggaaatggtccaagaggaaaatgatcaggggtcctccacaggctatgattttaaggag
cccaatagacacttaaaatacggccccgaagagaaggctaatgagcgtctgccagaaagt
gagtctctttgtgaagtggtcgtcagattgaaaccatttttaaataatgttgttctgtct
accgccaacaaaatcagtcaagaatcgtgtgttatagttgggcatggcagctctgtaaga
tctctgctgaaagtattggaaggtatctcagatgaagacatcaaagatgtcgatattccc
aacggcattccgctagttatagagttggatagagacaattactcttttgtgaggaaattt
tacttggatccagaatcagctaaagttaatgctcaaatggttcgtgatgagggtttcgaa
aagaatccatga

DBGET integrated database retrieval system