KEGG   Saccharomyces cerevisiae (budding yeast): YOL064CHelp
Entry
YOL064C           CDS       T00005                                 

Gene name
MET22, HAL2
Definition
Met22p (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    YOL064C (MET22)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     YOL064C (MET22)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    YOL064C (MET22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(206103..207176)
Genome map
AA seq 357 aa AA seqDB search
MALERELLVATQAVRKASLLTKRIQSEVISHKDSTTITKNDNSPVTTGDYAAQTIIINAI
KSNFPDDKVVGEESSSGLSDAFVSGILNEIKANDEVYNKNYKKDDFLFTNDQFPLKSLED
VRQIIDFGNYEGGRKGRFWCLDPIDGTKGFLRGEQFAVCLALIVDGVVQLGCIGCPNLVL
SSYGAQDLKGHESFGYIFRAVRGLGAFYSPSSDAESWTKIHVRHLKDTKDMITLEGVEKG
HSSHDEQTAIKNKLNISKSLHLDSQAKYCLLALGLADVYLRLPIKLSYQEKIWDHAAGNV
IVHEAGGIHTDAMEDVPLDFGNGRTLATKGVIASSGPRELHDLVVSTSCDVIQSRNA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcattggaaagagaattattggttgcaactcaagctgtacgaaaggcgtctttattg
actaagagaattcaatctgaagtgatttctcacaaggactccactactattaccaagaat
gataattctccagtaaccacaggtgattatgctgcacaaacgatcatcataaatgctatc
aagagcaattttcctgatgataaggtagttggtgaagaatcctcatcaggattgagcgac
gcattcgtctcaggaattttaaacgaaataaaagccaatgacgaagtttataacaagaat
tataaaaaggatgattttctgtttacaaacgatcagtttccgctaaaatctttggaggac
gtcaggcaaatcatcgatttcggcaattacgaaggtggtagaaaaggaagattttggtgt
ttggatcctattgacggaaccaaggggtttttaagaggtgaacagtttgcagtatgtctg
gccttaattgtggacggtgttgttcagcttggttgtattggatgccccaacttagtttta
agttcttatggggcccaagatttgaaaggccatgagtcatttggttatatctttcgtgct
gttagaggtttaggtgccttctattctccatcttcagatgcagagtcatggaccaaaatc
cacgttagacacttaaaagacactaaagacatgattactttagagggagttgaaaaggga
cactcctctcatgatgaacaaactgctatcaaaaacaaactaaatatatccaaatctttg
cacttggattctcaagccaagtactgtttgttagcattgggcttagcagacgtatattta
cgtctgcctatcaaactttcttaccaagaaaagatctgggaccatgctgcaggcaacgtt
attgtccatgaagctggaggtatccatacagatgccatggaagatgttcctctagacttc
ggtaacggtagaacgctagctacgaagggagttatagcgtcaagtggcccacgcgagtta
catgacttggtggtgtctacatcatgcgatgtcattcagtcaagaaacgcctaa

DBGET integrated database retrieval system