KEGG   Saccharomyces cerevisiae (budding yeast): YOL139CHelp
Entry
YOL139C           CDS       T00005                                 

Gene name
CDC33, TIF45
Definition
Cdc33p
Orthology
K03259  
translation initiation factor 4E
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YOL139C (CDC33)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    YOL139C (CDC33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(60383..61024)
Genome map
AA seq 213 aa AA seqDB search
MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSD
LLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLR
GKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGG
KFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgaagaagttagcaagaagtttgaagaaaacgtttcagtcgatgataccaca
gctactccaaagactgttttaagtgacagtgctcacttcgatgtcaagcacccattgaac
accaaatggactttatggtacacaaagccagccgtcgataaatctgagtcgtggtctgat
ctattacgtcccgtcacttcattccaaactgttgaagaattttgggctatcattcaaaat
attcctgagccacacgaactaccattgaaatcagattaccacgtcttccgtaatgacgtt
agacctgaatgggaagatgaagccaatgctaaaggtggtaaatggtctttccaacttaga
ggaaaaggtgctgatattgatgaattatggctaagaactttactagcagttattggtgaa
acaattgatgaagacgactcccaaattaacggtgtcgttttaagcattagaaaaggtggt
aacaagtttgccttatggactaaatctgaagacaaagaaccactattgagaattggtggt
aaattcaagcaagttttaaaattaaccgatgacgggcatttggaattctttccacattcc
agtgccaatggtagacaccctcaaccatcaatcaccttgtaa

DBGET integrated database retrieval system