KEGG   Saccharomyces cerevisiae (budding yeast): YOL147CHelp
Entry
YOL147C           CDS       T00005                                 

Gene name
PEX11, PMP24, PMP27
Definition
Pex11p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:complement(47933..48643)
Genome map
AA seq 236 aa AA seqDB search
MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRK
FLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVT
VLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLG
KAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgatacactggtatatcatccctccgtgacgagattcgtcaaatttctagat
ggctcagctggcagagaaaaggttctcagattactgcagtatttagcaagatttttagca
gtacagaactcatctctcttggccaggcaattacaagctcaatttaccacagtcagaaaa
tttctgaggtttctgaagcctttaaaccacttgcaggcagctgctaaattctacgataac
aagttggccagcgacaacgtcgttagagtctgcaatgttttgaaaaacatcttctttgct
gcatatttgtcgttagatcaagtcaatcttttgagaattttgaaagtgattcctgtaacc
gttcttaccggtaagaaaatacctcgctggtccaattggtgttggctgttcggcctccta
agtggtctggctatggatcttcgtaagatccaaacatctcatgcccagattgctgcgttt
gtcaaggcaaaatcacaaagccaaggcgatgagcatgaggatcacaagaaggtactaggg
aaggcataccaagacaggtacaccgcgttaagaagactattctgggatgctgcagattcg
ttcatcgtcctcaacaacctagggtacttgtctagcaacgaagagtatgttgcgctatcc
ggtgttgtcacatctatccttggtatgcaagacatgtggaaagctacatag

DBGET integrated database retrieval system