KEGG   Saccharomyces cerevisiae (budding yeast): YOL164W-AHelp
Entry
YOL164W-A         CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:4130..4312
Genome map
AA seq 60 aa AA seqDB search
MFAKLYRGLTYVTNKILSTLLSHHSIHYCINSFKPTTLAIIILLHPCCRCNVYIIRCIHH
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctaagctttatcgcggtcttacttacgttaccaacaaaattctatctacattg
ctatcacatcattccatacattattgcataaattcctttaagccgactacattggcaatt
ataattcttctacacccctgttgccgttgtaatgtttacattattagatgcatccaccat
taa

DBGET integrated database retrieval system