KEGG   Saccharomyces cerevisiae (budding yeast): YOR026WHelp
Entry
YOR026W           CDS       T00005                                 

Gene name
BUB3, PAC9
Definition
Bub3p
Orthology
K02180  
cell cycle arrest protein BUB3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOR026W (BUB3)
Spliceosome [BR:sce03041]
 Complex A
  Other components
   Complex A specific factors
    YOR026W (BUB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:379781..380806
Genome map
AA seq 341 aa AA seqDB search
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagtacaaattgagcaggccccaaaagactacataagcgacatcaaaataatc
ccttccaagtcactgcttttgattacgtcttgggatggctctttaacagtctacaaattc
gacattcaagcaaagaatgttgaccttttacaatcgctacgatataaacatccgttattg
tgctgcaatttcatcgacaataccgatctgcaaatatacgtgggaactgtacagggtgaa
attctaaaagttgatttgataggtagtcccagcttccaagctttgacgaacaatgaagcc
aatttgggtatttgccgaatatgcaaatatggagacgataaactcattgccgcgtcatgg
gatggcctgatagaggttatcgaccctcgcaattatggtgatggagttattgctgttaaa
aatttgaactctaataacacaaaggtgaagaataagatatttactatggatacaaactcc
tctcgattgatcgttggtatgaacaatagtcaggttcaatggtttcgcctgccactctgt
gaggatgataacggaacaattgaagaatcaggactgaagtaccaaataagagatgtcgct
cttttaccgaaagaacaagaaggttatgcatgtagcagcattgacgggcgagttgctgtg
gagtttttcgatgatcagggcgatgattacaactcaagcaaaagatttgcatttagatgc
caccgtttgaatttaaaagatacaaacttagcgtatccagtaaattctattgaattttcc
ccccgtcataagttcctatacacggctggctctgatggcataatttcatgctggaaccta
caaacccgcaagaaaataaaaaatttcgccaaatttaacgaagacagcgtggttaaaatt
gcttgttcggacaatattctatgtctggcaacttctgatgatactttcaagacaaacgcc
gcaattgaccaaactattgaactaaacgcaagttcaatatacataatatttgactatgag
aactga

DBGET integrated database retrieval system