KEGG   Saccharomyces cerevisiae (budding yeast): YOR076CHelp
Entry
YOR076C           CDS       T00005                                 

Gene name
SKI7
Definition
Ski7p
Orthology
K12595  
superkiller protein 7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    YOR076C (SKI7)
  Folding, sorting and degradation
   03018 RNA degradation
    YOR076C (SKI7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:complement(469377..471620)
Genome map
AA seq 747 aa AA seqDB search
MSLLEQLARKRIEKSKGLLSADQSHSTSKSASLLERLHKNRETKDNNAETKRKDLKTLLA
KDKVKRSDFTPNQHSVSLSLKLSALKKSNSDLEKQGKSVTLDSKENELPTKRKSPDDKLN
LEESWKAIKEMNHYCFLKNDPCINQTDDFAFTNFIIKDKKNSLSTSIPLSSQNSSFLSLK
KHNNELLGIFVPCNLPKTTRKVAIENFNRPSPDDIIQSAQLNAFNEKLENLNIKSVPKAE
KKEPINLQTPPTESIDIHSFIATHPLNLTCLFLGDTNAGKSTLLGHLLYDLNEISMSSMR
ELQKKSSNLDPSSSNSFKVILDNTKTERENGFSMFKKVIQVENDLLPPSSTLTLIDTPGS
IKYFNKETLNSILTFDPEVYVLVIDCNYDSWEKSLDGPNNQIYEILKVISYLNKNSACKK
HLIILLNKADLISWDKHRLEMIQSELNYVLKENFQWTDAEFQFIPCSGLLGSNLNKTENI
TKSKYKSEFDSINYVPEWYEGPTFFSQLYLLVEHNMNKIETTLEEPFVGTILQSSVLQPI
AEINYVSLKVLINSGYIQSGQTIEIHTQYEDFHYYGIVSRMKNSKQILETNTKNNISVGL
NPDILEVLVKIHNTEDFTKKQFHIRKGDIIIHSRKTNTLSPNLPNTLKLLALRLIKLSIQ
THALSDPVDLGSELLLYHNLTHNAVKLVKILGTNDISINPNQSLIVEVEIIEPDFALNVI
DSKYITNNIVLTSIDHKVIAVGRIACQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttattagagcaattagcaagaaaaagaatagaaaaatctaaaggccttttaagt
gcggaccagtctcatagtacatcgaaaagtgcatccttactagaaagactacataagaat
agagaaactaaagataacaatgctgagacaaaaaggaaggatctgaagacgctacttgca
aaagacaaggtaaaaagaagcgactttaccccgaaccagcatagtgtttcattgagttta
aagttgtctgccttaaagaagtcaaatagtgatttggagaaacaaggaaaatcagtgaca
ttagacagcaaagaaaacgaactccctaccaaaaggaaatcgcctgatgataaactcaac
ttagaagagtcatggaaggctattaaagaaatgaaccattactgtttcttgaaaaacgat
ccatgcataaatcaaaccgacgattttgcgttcacaaactttatcataaaagataaaaaa
aactcgttgagtacatcaataccgctatcgtcgcagaattcatcatttctgtccttaaaa
aagcataacaatgagctccttggtatttttgtgccttgtaacctgccgaaaacaactcgt
aaagtagccattgagaatttcaatagaccaagtcctgatgatataatacaatcggcccaa
cttaatgctttcaatgaaaaattagaaaacttaaatatcaaatctgtgcccaaggccgaa
aaaaaggaaccaattaaccttcaaacaccacctactgagtcgattgatattcattcattc
attgccacccatcctctgaatttgacatgtttgttcctcggtgatacaaacgcaggcaaa
tccactttgcttggtcatcttttatatgatctaaacgaaatttctatgtcatcaatgagg
gaactacaaaaaaaaagcagtaatttggatccttcatcttcaaatagttttaaggtcatt
ctagacaataccaaaacagaaagagaaaatggattttccatgtttaagaaagttattcag
gtagaaaatgatttactaccgccatcatcaaccttgacgcttatagacactcctggtagt
atcaaatacttcaataaagaaactctgaactcaattttgacctttgatcctgaagtttat
gtattggttattgattgcaattatgactcgtgggaaaaatcattagatggtccaaataat
cagatttatgaaattttaaaagtgatctcttatttgaacaagaattccgcatgcaaaaag
cacttgataattcttttgaataaggcagatctaattagttgggataagcaccgactagaa
atgattcagtctgagctaaattatgtgttgaaggaaaactttcagtggacagacgcagaa
ttccaatttatcccgtgttcgggtttattaggttcgaatttgaataaaactgaaaacatc
acaaaatctaagtataagtcagaatttgactctataaattatgttcccgaatggtatgaa
ggtccgacatttttttcgcaactatatctattggtagagcataatatgaacaaaatagaa
acaactttggaagagccatttgtaggcacaatactgcaatcttctgttcttcaaccgata
gcggagataaattacgtgtcactcaaagtcttgatcaacagcggatatattcaatcaggc
cagacaattgaaattcatacacaatatgaagattttcattactatggtatagtttcaaga
atgaagaattcaaaacaaatactggagactaacacaaaaaataatatatcagtcggtttg
aaccctgacattttagaggttcttgttaagattcataataccgaagacttcacgaaaaag
caatttcacattcgtaagggtgatataataattcactctagaaagacgaatacactatca
ccgaatttaccaaacacactaaagttgttagccttgcgtttaataaaattatcaatacaa
acgcacgcgctaagtgatcccgttgacttgggttctgaattgcttctttaccataatttg
acgcacaacgcggtaaaattggtgaagattctcgggactaacgacatctcaattaatcca
aatcagtcacttattgtcgaagtcgaaattatagaaccagactttgctcttaatgtgatt
gattccaaatacattaccaacaatattgttttaacatcaatagatcataaggttatcgca
gttggcagaattgcatgccagtaa

DBGET integrated database retrieval system