KEGG   Saccharomyces cerevisiae (budding yeast): YOR083WHelp
Entry
YOR083W           CDS       T00005                                 

Gene name
WHI5
Definition
Whi5p
Orthology
K12413  
G1-specific transcriptional repressor WHI5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOR083W (WHI5)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Other transcription factors
   Others
    YOR083W (WHI5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:479533..480420
Genome map
AA seq 295 aa AA seqDB search
MSLRTPKRSRTSDEQEQEQEQEQVQNPDTHVNNEHQQRPGPTTLLSTPVRLKNGFGTPSP
PSPPGITKSITKSRRRPSTTSLQGIFMSPVNKRRVGITAHGRVYDHNDDGHESESEDDEN
EEENENQKKYDGHVSMPLLPPTTPKSRRSEVFLSPSPRLRSPPTAARRSTGERPIREISH
TLRTRLNYALVKLQNGWTDKTLPELETELAPAVQTPPRRYHNRFPDSADAGTSAHTAFLQ
ALGGHPPREEATAVETLMLLSSPTKKQQHRPVPATSAGEPTDETEPESDTEVETS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgagaacgccgaagagaagcaggactagcgatgaacaagaacaagaacaagaa
caagagcaggtacagaacccagatacacatgtaaacaacgagcatcagcagcgacctggg
ccaaccactctattgagcacgccagtacgtctcaaaaatggctttggaacaccatcgccg
ccgtcaccaccaggcataacgaaaagcatcactaaatcgagaagaaggccgtcgacaacg
agtcttcagggtatattcatgtcgcccgtcaataagcgtcgtgtcggcataaccgcacat
ggacgtgtatatgaccataacgacgacggacacgaaagtgagagtgaggacgacgaaaat
gaagaagaaaatgaaaatcaaaagaagtacgacggacacgttagtatgcctttgttgcca
ccgacaacgcccaagtcaagacggtcggaggtgtttctgtcgccgtcgccgcgtttgagg
tcacctccgacggctgcgcgtcggtctacgggcgagcggcccatccgcgaaatatcacat
actttgcgcaccaggctcaattacgcgttagtcaagctgcaaaatggatggacggacaag
acacttcccgagctggagacggagcttgctccagcagtgcagacgccgccacgtcgctat
cacaacagatttccagatagtgcagacgcgggtacttccgcgcatacagcgtttcttcag
gcgctcggaggccacccaccacgggaggaggccacggctgtcgaaacactgatgctattg
tcgtcgcctaccaagaagcaacaacaccgacccgtgccggcgacatctgctggagaaccc
acggacgaaacggagcccgagtcggataccgaagtggagacgtcttaa

DBGET integrated database retrieval system