KEGG   Saccharomyces cerevisiae (budding yeast): YOR122CHelp
Entry
YOR122C           CDS       T00005                                 

Gene name
PFY1, CLS5, PRF1
Definition
Pfy1p
Orthology
K05759  
profilin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(join(552298..552665,552875..552887))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY
LIGVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcatacactgataacttaataggaaccggtaaagtcgacaaagctgtc
atctactcgagagcaggtgacgctgtttgggctacttctggtggcctatctttgcaacca
aacgaaattggtgaaattgttcaaggcttcgacaatccagctggtttgcaaagcaatggt
ttgcatattcaaggccaaaagttcatgttgttgagagctgacgatagaagtatctacggt
agacatgatgctgagggtgttgtttgtgtaagaactaagcaaaccgttattattgctcat
tatccaccaaccgtacaagccggtgaggccaccaagattgtcgagcaattggctgactac
ttgattggtgttcaatactaa

DBGET integrated database retrieval system