KEGG   Saccharomyces cerevisiae (budding yeast): YOR124CHelp
Entry
YOR124C           CDS       T00005                                 

Gene name
UBP2
Definition
Ubp2p (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YOR124C (UBP2)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YOR124C (UBP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:complement(554824..558642)
Genome map
AA seq 1272 aa AA seqDB search
MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL
YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR
PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH
LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK
LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG
PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD
YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF
HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY
FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK
YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ
EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL
TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN
SGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV
EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNE
SNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR
YDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSY
FKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDR
YADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIK
KTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFI
HRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQ
EGDIEPLKRILK
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgaagataatgaacttcaaaaagcaattgagaaccatcataatcaactacta
aaccaggataaagaaaatgctgacagaaatgggtctgttatagaagacctcccattatac
gggacaagtataaaccagcagtctacccctggagatgttgacgatggaaaacacttactg
tatccagatattgccaccaacctaccactgaagacttctgacagacttttggacgatata
ctttgcgatactatttttctcaattctacagacccgaaggtcatgcaaaagggcctgcaa
tcgaggggtattttaaaagagtctatgctttcttactcaactttcagaagtagtattcgc
cctaactgcttgggttcattaactgatcaagtggtttttcaaacaaaatccgagtatgat
tccatttcatgcccaaaatataataaaatacatgtatttcaggcggtcatctttaatcca
tcactggcagaacagcaaatttcaacttttgatgatattgttaaaattcctatttatcat
cttaaggttagcgtaaaagtccgccaagaactggagcggttgaagaagcatgtcggtgtt
actcaattccactcactagatcatttgcacgaatacgatcgagtagacctttcgactttt
gattcttccgatcctaatttgttggattacggtatttacgtttctgatgatactaacaaa
ctgatcttgattgaaatttttaaacccgagtttaattcacctgaagagcatgagagtttt
actgccgacgcaattaagaagagatacaatgctatgtgtgtaaaaaatgaatcactagat
aaaagcgagacgccatctcaagttgactgtttttacacactttttaaaatttttaaaggg
cctttgacgaggaaaagtaaagcggaacctacaaagacaattgattctggaaatttggcc
cttaacactcacctgaatcctgaatggttaacgtccaagtatggatttcaagcaagctca
gaaatcgatgaggaaactaatgagatatttactgaatacgtccctccagatatggtggac
tatgtaaacgatttggagacaagaaaaattcgagaatcgtttgtgaggaagtgtttacaa
ctgatattttggggtcaactatctacctcattactggcacctaattctcccttgaaaaat
acgaaaagcgtaaagggaatgtcttcattacaaacttctttctcaacactaccttggttc
catttattgggagaatccagagcaaggattctattaaattccaatgagcaaactcattcg
cctttggacgcagaacctcattttattaatctttccgtttcgcattattataccgataga
gatataatcagaaactacgaatctttgtcttctttggatcctgaaaatattgggctgtat
tttgacgcactgacatacattgcaaataggaagggggcatatcaattgattgcttactgt
ggaaaacaggacattataggccaagaagctctagaaaatgctttgttaatgtttaaaatt
aaccctaaagagtgtaacatctccgaattaaatgaggcgactttgctatctatttacaaa
tatgaaacatcaaataagagccaagtaacctctaatcacctaacaaatttgaaaaatgct
ctaagattgttggccaaatataccaaatctgacaaactaaaattttacgtcgatcatgag
ccctacagagctttatcccaggcatacgacacactttcaattgacgagtctgttgatgaa
gacattataaaaactgcatattcggtcaagattaacgactctcccggattaaagttggat
tgtgatagagcactttacaccattgctatcagtaaaagaagccttgatttgttcaatttt
ttaacagaggaatgcccacagttttccaactattatggtccagagaagcttgattaccaa
gaggcattgaagcttcttcaagtgaatgaaaatgcctctgacgaaaccattttgaaaatc
tttaaacaaaagtggtttgatgaaaacgtttatgagcctgaccaatttcttattttgagg
gcagcattgaccaaaatcagtatagaaagaaattcaactttaatcaccaacttcttacta
actggtacgatagatccaaattccttgccgccagaaaattggccaactggcattaataat
atcgggaacacctgttacctaaattctttattacaatattacttttccattgcgccacta
agaagatatgtattggaatatcaaaaaacggtagaaaatttcaatgaccacctctctaat
agtgggcatattagaagaattggtggaagagaaattagtagaggcgaagtggaaagatct
attcaattcatataccaacttcgcaaccttttctatgcgatggttcatacaagagaaaga
tgtgtaacaccctcaaaagagctagcatatttggcatttgctccaagtaatgttgaagta
gaatttgaagtggaaggcaataaagtagttgatcaaacaggagttctttcggattcaaag
aaggaaacaacggatgacgcatttactacaaaaataaaggatacaagcctgattgattta
gaaatggaagatggccttaatggcgatgttggtacagatgcgaacagaaaaaaaaatgaa
tcgaatgatgctgaagtaagtgagaacgaagatacaacaggattaacttcacctacgcgt
gtggcaaaaatcagttctgatcaattagaaaatgctttggaaatgggtaggcaacaagat
gttactgaatgcataggaaacgtgttatttcagatagaaagcggttcagagcctatccga
tatgatgaagacaacgagcaatatgacttggttaagcaactattttatggtactactaaa
caaagtattgttcctttgtccgcaacaaataaagtccgtacgaaagttgaaagattccta
tcgttactgataaatattggcgatcatcctaaagatatttatgatgcgtttgattcttat
tttaaagacgaatatctgacaatggaagagtatggtgatgttatacgtaccgttgctgtt
acaacttttcctactattttgcaggtacaaatccaaagagtttattacgatcgtgaaaga
ttaatgccgtttaaatccattgagcccttaccattcaaagaagttatttacatggacaga
tacgcggatacagagaaccctttattgttggcaaaaaagaaagaaacagaagaaatgaag
caaaagttgaaggtaatgaaaaatagacaaagagagcttttgagtcgtgatgattcaggg
cttacaaggaaggatgcatttttggagagtatcaagctattggaatcggataccataaag
aaaactcctttaaaaattgaggctgctaatgatgtgataaagacgctgagaaacaacgtt
caaaatatcgataatgaattgatgaaattatacaatgatatcaacagtttggaagagaaa
ataagccatcaatttgacgatttcaaggaatatggttactcactgttttcggtttttatt
catcgcggcgaggccagttatggtcactattggatatatatcaaggacagaaatcgcaat
ggaatttggaggaagtacaatgatgaaaccatcagtgaggtccaggaagaggaggtcttc
aatttcaatgagggtaacactgcaactccatatttcctagtatatgtcaaacaaggacaa
gaaggtgatattgagccattgaaaagaattctaaagtag

DBGET integrated database retrieval system