KEGG   Saccharomyces cerevisiae (budding yeast): YOR171CHelp
Entry
YOR171C           CDS       T00005                                 

Gene name
LCB4
Definition
sphinganine kinase LCB4 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    YOR171C (LCB4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     YOR171C (LCB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:complement(652010..653884)
Genome map
AA seq 624 aa AA seqDB search
MVVQKKLRAILTDEGVLIKSQSHHMFNKHGQLRSGDSLSLLSCLSCLDDGTLSSDGGSFD
EDDSLELLPLNTTIPFNRILNAKYVNVGQKGFNNGKISSNPFQTENLSSSSENDDVENHS
LSNDKAPVSESQSFPKKDKWDTKTNTVKVSPDDSQDNSPSLGIKDNQQLIELTFAVPKGH
DVIPQKLTLLIDHVSRKSRANTGEENISSGTVEEILEKSYENSKRNRSILVIINPHGGKG
TAKNLFLTKARPILVESGCKIEIAYTKYARHAIDIAKDLDISKYDTIACASGDGIPYEVI
NGLYRRPDRVDAFNKLAVTQLPCGSGNAMSISCHWTNNPSYAALCLVKSIETRIDLMCCS
QPSYMNEWPRLSFLSQTYGVIAESDINTEFIRWMGPVRFNLGVAFNIIQGKKYPCEVFVK
YAAKSKKELKVHFLENKDKNKGCLTFEPNPSPNSSPDLLSKNNINNSTKDELSPNFLNED
NFKLKYPMTEPVPRDWEKMDSELTDNLTIFYTGKMPYIAKDTKFFPAALPADGTIDLVIT
DARIPVTRMTPILLSLDKGSHVLEPEVIHSKILAYKIIPKVESGLFSVDGEKFPLEPLQV
EIMPMLCKTLLRNGRYIDTEFESM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgcagaaaaaacttagggctatcttgaccgatgaaggtgtattgatcaaatcg
caatcacaccatatgttcaataagcatggtcaactcagaagcggagattctttatccttg
ttgagctgcttgtcctgtctggatgatggaactttgagctctgatggaggttcttttgat
gaggatgattccctggaactgttgcctcttaatactaccattccgttcaacagaattttg
aacgcaaaatatgtgaatgtcggtcagaaaggcttcaataatggcaaaatttcttcgaat
ccttttcaaacggaaaatctgagttcttcgtctgaaaatgacgacgttgagaatcatagt
ttgagcaatgataaggctcctgtaagcgaatcacagtcatttcccaaaaaagacaagtgg
gatacaaaaacgaacactgtgaaggtgtctcccgatgattcacaggataactcaccatct
ttagggataaaagataatcaacagttaattgagttaacttttgctgtacccaagggccat
gatgttataccacaaaaattaaccttgttaatagatcacgtttctaggaaatcgagagca
aataccggagaggagaacatttcttctggtactgtggaagaaatcctggaaaaaagttat
gaaaattccaagagaaacagatcgatattagtcattattaatccccacggtggtaaaggt
actgctaaaaatttattcctgacaaaagcaaggccaatactagtggaaagtggctgcaaa
atagaaattgcatacacaaaatatgcccgtcacgccatcgatattgccaaagatttagat
atcagcaaatacgataccattgcatgtgcctcgggtgatggtattccatacgaagtaatt
aatgggctttatagaagacccgacagagtggatgcgttcaataaactagccgtaactcag
ctaccttgcggttcaggaaatgctatgagcatttcatgtcattggacaaataacccatcg
tacgccgctctgtgccttgtcaaatccattgaaacaagaatagacttaatgtgttgttcc
caaccttcttatatgaacgaatggccaagattatcctttttgagtcagacgtacggcgtt
attgcagaatctgatattaacactgaattcatcagatggatgggtcccgttaggtttaat
ttgggtgtagcattcaacattatccaaggtaagaaatatccctgcgaagttttcgtcaaa
tatgctgccaaatctaaaaaggaattaaaagttcatttcttagaaaataaagataaaaac
aaaggatgtttaaccttcgaaccaaatcctagcccaaactcttcgccggatttactatct
aaaaacaatatcaacaacagtacaaaagatgaactttcaccgaattttctcaacgaggac
aactttaaattaaagtatccgatgacggaaccagtacctagagactgggagaaaatggat
tcagagctaactgataacttaacaatcttttacacagggaaaatgccgtatattgctaag
gacaccaaattttttcccgctgctttaccagcggatggtaccattgatttagtcataacg
gatgcaagaatcccagtgacaagaatgacaccaattttattatccttggataaaggttct
catgtattagagccagaagttattcactcaaaaatattggcttataagattataccaaaa
gtggagtcaggtttattttcagtggatggtgaaaagtttcctttggaacccttgcaagtg
gaaataatgcccatgttatgcaagacgttgctaaggaatggtagatatatcgatacagag
tttgaatccatgtag

DBGET integrated database retrieval system