KEGG   Saccharomyces cerevisiae (budding yeast): YOR193WHelp
Entry
YOR193W           CDS       T00005                                 

Gene name
PEX27
Definition
Pex27p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:710446..711576
Genome map
AA seq 376 aa AA seqDB search
MTSDPVNTNISSPTLTDRNADESWELLKREFNTLFSNLKTDSKEEGNFTDNKGVIAKKPI
VLQDNDDSDFTQNQGKVATATSTTSDRSFKRTLGSIEMKKRYVKKNCQAKFVFNTLEGKE
VCSKILQHTLGLLSLLLLTRKIRLLNFSSKLRLVIQQLSLFRYYLRFGNFAINLYKIIKR
FRWLREMKKLHYKDQSILFYFKNFRFFDIIEAFYNLTDELILFHKLQSMFGKKNTSHANT
NRLMTFVKEQHYILWEVLNILAINKNIEQWRQLIRDEIYLSIYNTSGNAIKEYELKYKLP
TNDKVNLELRKNNITLDFYKIILNLLSNLINIKGKRDKYNSELAYEIISVGSGVTELLKL
WNRAKVTSANEHTSAV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacatccgatcctgttaatacgaatataagtagccccactttaacggacagaaatgca
gacgaatcatgggagctcttgaaaagagagtttaacacattatttagcaacctgaaaact
gacagtaaagaagaaggtaatttcacagacaacaaaggagtaatcgccaagaaaccaatt
gttctgcaggataatgatgattcggattttacgcagaatcagggaaaagttgctactgca
accagtacaactagtgacagaagctttaagcgaacacttggttctattgaaatgaaaaaa
cgttatgttaagaaaaattgccaagcaaaatttgtttttaacacgcttgaaggtaaagaa
gtttgttcgaaaatactacaacataccctaggcctattaagtttattgctattgacgaga
aagatacgactactaaatttttcctcaaaactgcgattggtgattcaacaattgagttta
tttcggtactatttgagattcggaaactttgcgatcaatttatataaaattatcaaaaga
tttcgctggttgagagaaatgaaaaaactacattataaagatcaatcaattttattttat
tttaaaaatttccggtttttcgacattattgaagctttttataatttgacagatgagttg
atactgttccataagctacaatcaatgtttggtaaaaagaacacatcacatgcaaatact
aatagactaatgacattcgtcaaagaacagcactatatcttatgggaagttttaaatatt
cttgctatcaataaaaacattgaacaatggcgacagctaataagagatgaaatttattta
agtatctataataccagtggtaatgcaataaaggaatacgagttaaagtacaaactacct
accaatgacaaagtcaatttggagttacggaaaaataatattacattggatttttataag
ataatactaaacttattgtctaatctaattaatattaaaggtaaaagggacaaatataac
tcagagctagcttacgaaataatttcagtaggttccggtgttactgaactccttaagcta
tggaaccgagccaaagtcacttcggctaatgaacatacaagcgctgtttga

DBGET integrated database retrieval system