KEGG   Saccharomyces cerevisiae (budding yeast): YOR195WHelp
Entry
YOR195W           CDS       T00005                                 

Gene name
SLK19
Definition
Slk19p
Orthology
K12575  
kinetochore protein SLK19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOR195W (SLK19)
   04113 Meiosis - yeast
    YOR195W (SLK19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:712866..715331
Genome map
AA seq 821 aa AA seqDB search
MNEVPTTPVRLILGQAQQREQNSENCSQERNPRTFNSEPDSSFNSPGSSQFVIHPHEPLE
KEKDEKQDLDRSIDYGRSSALNNKNNANPLENIDINKMFDDKKSDSGTNDDKGGASTSDK
HVLALNYSPIRVEMNSSEKRSDKNVDVDENDKEGSHINKKLKLQLESVPDLKQSSTKDII
NDKEEIMSSPMAIDMIETNISPNKFIINDGVERNDSFNINTDTLKLENDINEKQQEEDFI
KSNSNNVVNIDNAYKEKEDEENDITNSHINRLTPLYETSARESNSNEEGRNDYDDDNQLD
IRHDNFQIVAKRNEELTDQIYHLNQMLNSLISKNESLSFQYEKLNKNHQLLIDLTNEKLD
KLNTERESDIAKVEKFKKRIKELNTEIKVLNSNQKILQEKFDASITEVNHIKGEHENTVN
TLQQNEKILNDKNVELENMKAELKGNNDKLSEYETTLNDLNSRIVQLNDKIESTDIVLKS
KENELDNLKLSLKETLSISKDFNDSDLIGQINELISTKNNLQQKMDDLNNLNDDNLKVVQ
DKLIKNEETLKLKEAEIDSLNSEMDELKKQITSKDDEFKMWQSKYETVEDEAKIRNAEVT
ELNGDIEDLKESKLHLEETITELENKVHKLENECELEKQKFEKTSLELESLQLKNSNIQA
EHIKELENLHENLISLQNELKISSDRITTLTKENEVLMEQNNNNNNSVTLSNDQKDRDDE
KIKSLGKQVQDWKEKYEAKEKDTNKRLKLLAEDLYIQYSSKHEQKVKLLKKGYENKYQNK
FDQLNLENKTLSEEIEQLNKQLSSEREEKQELLKLLENEKK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagttcctaccactccagttaggcttattttagggcaagctcagcaacgcgag
cagaattcagaaaactgttcgcaagaacgtaacccacgcacgtttaattccgaaccggat
tccagctttaactctcctggttcctcccagttcgtgatacatcctcatgaaccgctcgag
aaggagaaagatgagaagcaggatttagaccgctcgattgattacggtaggtcatcagct
cttaacaacaagaataatgccaatccattagagaatatagacataaataaaatgtttgat
gacaaaaaatcagattcaggtaccaatgatgataaaggaggcgcaagtactagtgataag
catgtccttgcattgaattattcaccgatcagagttgaaatgaactcctcagagaaacga
agcgacaaaaacgtggacgtagatgaaaatgataaagaaggtagccatattaataaaaaa
ttgaaattgcagttagaatcagtacctgatttgaaacaaagctctactaaagatatcatt
aatgacaaagaagaaattatgtcgtctccaatggcgattgatatgattgagaccaacata
agcccaaataaattcataataaacgacggagttgaaagaaacgatagtttcaatatcaat
accgacacacttaaattagaaaatgatataaatgagaaacaacaagaggaagacttcata
aaatctaacagtaacaatgtggttaatattgacaatgcttataaggaaaaggaggacgaa
gaaaatgatataacaaattctcatataaacaggcttactcctttgtatgagacttctgca
agggagtcgaactcaaatgaagaggggaggaatgactacgatgatgacaaccaacttgat
attagacatgacaattttcagattgtagcaaaaagaaacgaggagctcactgatcagata
tatcacttaaatcaaatgttaaactctttgatttccaaaaatgaatcattgtcttttcaa
tacgagaaattgaacaaaaatcaccaactactaatagatttgacaaatgaaaagttagat
aaactaaatacagaaagagagagcgatattgccaaggtggaaaaattcaaaaagaggatt
aaggagttgaatacagaaattaaggtattgaattccaaccaaaaaatattacaagaaaaa
ttcgatgcctcaattactgaagtaaatcatataaagggcgaacatgaaaatactgtcaac
actttgcagcaaaatgagaaaattttaaatgataaaaatgtagaactggaaaatatgaaa
gcagaattgaaaggcaataatgataaattatccgaatatgagaccacgttaaatgacttg
aattctcgcattgtgcaactgaatgataagattgaaagcacagatattgttttgaaatct
aaagagaacgaactagataatttaaaattgagtttgaaggaaactttatcgatttctaag
gacttcaacgactctgaccttataggacaaattaatgagctaatatctacaaaaaacaac
ttgcaacaaaaaatggatgatttgaataacctgaacgacgataatttgaaggtagtacag
gataaattaattaaaaatgaggagacgctaaaactaaaagaagctgaaattgattcattg
aatagtgaaatggacgagctaaaaaaacagatcacttcaaaagatgatgaatttaagatg
tggcaaagtaaatacgaaactgtcgaagacgaagctaagatacgcaatgccgaagttaca
gagttgaacggagatattgaagatctaaaggaatcaaaattgcatttggaagaaacaatt
acggaactagaaaacaaagttcataaactagaaaatgagtgtgaactggagaaacaaaaa
ttcgaaaaaacttcgctagaattagaaagcttacaactaaaaaatagtaacattcaggct
gagcacatcaaagaattggaaaatcttcatgaaaaccttatttctcttcaaaatgaattg
aagatttcatccgacaggataacaacattaacaaaagaaaatgaagtattaatggaacaa
aataataataacaataatagcgttactttaagcaatgatcaaaaggatagagatgatgaa
aaaattaaatcattaggaaaacaagtacaagattggaaagaaaagtatgaggccaaagaa
aaagatacaaataaaaggctaaagttattagcagaagatttgtatatccagtattcatcc
aaacacgaacaaaaggtcaaactgttgaaaaaaggctatgaaaacaagtaccaaaataag
tttgatcaattaaatttagaaaataaaactctgtcagaagaaatcgagcaattgaacaag
cagctgtcttcagaaagagaagaaaagcaggagttactcaagttgttagaaaatgaaaaa
aaataa

DBGET integrated database retrieval system