KEGG   Saccharomyces cerevisiae (budding yeast): YOR231WHelp
Entry
YOR231W           CDS       T00005                                 

Gene name
MKK1, SSP32
Definition
Mkk1p (EC:2.7.12.2)
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YOR231W (MKK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     YOR231W (MKK1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   YOR231W (MKK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:772601..774127
Genome map
AA seq 508 aa AA seqDB search
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTS
TLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLG
LKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSS
PIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKL
KNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAME
YMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNEN
GQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKF
PCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPR
QMINHPWIKGQMKKNVNMEKFVRKCWKD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgttcagacccccagaatctgcgaaatgcaacccaaactctcctagactt
aaactgcccctcttacgaaataatcaggtagatgaaaataatatatacttgacgtcgaat
gggagttccaccacagcttacagtagccacaccccagaaccactgacctcttccacatcg
acacttttctcccaaactcgacttcatcctagcgactcttcaatgactttaaatacaatg
aagaagaggcctgcaccgccatctttaccttcgctcagcataaattcacagtctaagtgc
aaaacactacccgaactcgtacccatcgccgatgtgtctgatggtaaacatgatttagga
ttgaaacagcgtgtgatagccgaaaatgagttgtctggtaatagtgacttaaccccttca
tcgatggcaagccccttttcacatacaaacacctcttctccctacctcagaaatgatctg
agcaattcagtgggatctgacttttcaaatttgatatcggcatatgaacaaagttcaagt
cccatcaagtcatcgtcccagcctaaatcatcttctgaatcgtacatagacttaaacagt
gtacgagatgttgatcaattggatgaaaatggttggaaatatgcaaatttaaaagatagg
atcgagacattaggcattctaggagaaggagccggtggctctgtttccaagtgtaaattg
aaaaatggatcaaaaatattcgctttaaaagtgataaacacattaaatacagatcccgag
tatcagaagcaaatattcagagaattacagtttaataggagtttccaatccgaatatatc
gtacgatattatggaatgtttacggatgacgaaaactcttcaatttatattgctatggag
tacatgggtgggcgatcgttggatgctatttataaaaatttgttagagcgtggtggtagg
atcagtgaaaaagtcctggggaagattgcagaagcggtactaagaggactatcatatttg
catgaaaaaaaagttattcatagagatattaagccccagaatattttactgaatgaaaat
ggtcaggtgaaactttgtgattttggggtcagtggagaagccgttaactcgctagccaca
acattcacggggacgtcattctatatggctccagaaaggattcaaggtcaaccatacagt
gtcacatctgatgtatggtcacttggattaacgattttggaagtggcgaacgggaaattt
ccatgctcttccgagaagatggcagccaatatagctccctttgaattgttaatgtggatt
ttaacatttactcctgaattaaaggatgaacccgaatctaatatcatatggagtccatca
ttcaaatcctttatcgactactgtctgaaaaaagatagtcgtgaacggccatctccaaga
caaatgatcaatcatccttggataaagggtcaaatgaaaaaaaatgtcaatatggaaaaa
ttcgtgaggaagtgctggaaagattaa

DBGET integrated database retrieval system