KEGG   Saccharomyces cerevisiae (budding yeast): YOR236WHelp
Entry
YOR236W           CDS       T00005                                 

Gene name
DFR1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YOR236W (DFR1)
   00670 One carbon pool by folate
    YOR236W (DFR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YOR236W (DFR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:780906..781541
Genome map
AA seq 211 aa AA seqDB search
MAGGKIPIVGIVACLQPEMGIGFRGGLPWRLPSEMKYFRQVTSLTKDPNKKNALIMGRKT
WESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLESNFKEHLERIY
VIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEFLP
PKVELPETDCDQRYSLEEKGYCFEFTLYNRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggaaagattcctattgtaggaattgtggcatgtttacagccggagatgggg
ataggatttcgtggaggtctaccatggaggttgcccagtgaaatgaagtatttcagacag
gtcacttcattgacgaaagatccaaacaaaaaaaatgctttgataatgggaaggaagaca
tgggaatccataccgcccaagtttcgcccactgcccaatagaatgaatgtcattatatcg
agaagcttcaaggacgattttgtccacgataaagagagatcaatagtccaaagtaattca
ttggcaaacgcaataatgaacctagaaagcaattttaaggagcatctggaaagaatctac
gtgattgggggtggcgaagtttatagtcaaatcttctccattacagatcattggctcatc
acgaaaataaatccattagataaaaacgcaactcctgcaatggacactttccttgatgcg
aagaaattggaagaagtatttagcgagcaagatccggcccagctgaaagaatttcttccc
cctaaagtagagttgcccgaaacagactgtgatcaacgctactcgctggaagaaaaaggt
tattgcttcgaattcactctatacaatcgtaaatga

DBGET integrated database retrieval system