KEGG   Saccharomyces cerevisiae (budding yeast): YOR236WHelp
Entry
YOR236W           CDS       T00005                                 

Gene name
DFR1
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sce00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sce00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:780906..781541
Genome map
AA seq 211 aa AA seqDB search
MAGGKIPIVGIVACLQPEMGIGFRGGLPWRLPSEMKYFRQVTSLTKDPNKKNALIMGRKT
WESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLESNFKEHLERIY
VIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEFLP
PKVELPETDCDQRYSLEEKGYCFEFTLYNRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggaaagattcctattgtaggaattgtggcatgtttacagccggagatgggg
ataggatttcgtggaggtctaccatggaggttgcccagtgaaatgaagtatttcagacag
gtcacttcattgacgaaagatccaaacaaaaaaaatgctttgataatgggaaggaagaca
tgggaatccataccgcccaagtttcgcccactgcccaatagaatgaatgtcattatatcg
agaagcttcaaggacgattttgtccacgataaagagagatcaatagtccaaagtaattca
ttggcaaacgcaataatgaacctagaaagcaattttaaggagcatctggaaagaatctac
gtgattgggggtggcgaagtttatagtcaaatcttctccattacagatcattggctcatc
acgaaaataaatccattagataaaaacgcaactcctgcaatggacactttccttgatgcg
aagaaattggaagaagtatttagcgagcaagatccggcccagctgaaagaatttcttccc
cctaaagtagagttgcccgaaacagactgtgatcaacgctactcgctggaagaaaaaggt
tattgcttcgaattcactctatacaatcgtaaatga

DBGET integrated database retrieval system