KEGG   Saccharomyces cerevisiae (budding yeast): YOR244WHelp
Entry
YOR244W           CDS       T00005                                 

Gene name
ESA1, TAS1
Definition
Esa1p (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:792531..793868
Genome map
AA seq 445 aa AA seqDB search
MSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYN
KRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGVDGFSREN
TDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPW
YFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEID
GRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGY
NVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITL
LVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKK
RRTIDPNRLIWKPPVFTASQLRFAW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgacggaaaagaagaacctggtattgccaaaaagataaactcagtagatgat
attattatcaaatgtcaatgctgggtccaaaaaaatgatgaagaacgattagctgaaatt
ttatccataaacacaagaaaagcaccaccaaaattctatgttcactatgttaattacaac
aagcgtttagatgagtggattaccactgacagaataaacctggataaagaagtactatat
ccgaaactaaaggctactgatgaagataataagaaacaaaaaaagaagaaggcaacaaat
actagtgaaacgccacaagactctctgcaagatggtgtagatggtttctcaagagaaaat
acggatgttatggacttagataatctaaatgtacagggaataaaagatgagaacatatca
cacgaggatgagataaaaaagcttagaacctccggctctatgacacaaaatccacatgag
gtggctcgagttagaaatctcaatcgaatcattatggggaaatatgaaatagaaccatgg
tacttttctccatatcctattgaattaactgatgaagattttatatatatcgacgatttc
acgttgcagtattttggatctaagaaacaatacgaacgctacaggaagaaatgtacatta
agacatccgccaggaaatgaaatctacagagacgattatgtttcattctttgaaatcgat
ggtagaaagcaaaggacttggtgtcgaaacttgtgtttactttccaaacttttcctagat
cacaaaacattatactatgacgttgatccgtttttgttttattgcatgacgagacgagat
gagttgggtcaccatctggtgggatatttttccaaggaaaaagaatccgcggatggttac
aatgttgcatgtatcttaacactaccacaataccaaaggatgggatatggtaagttattg
attgaattttcgtatgaattgtcgaaaaaggaaaacaaagttggttctcccgagaaacct
ttgtctgatttgggtctcttatcctatagagcctattggtcggacactctcataacgcta
ttagtggaacaccagaaggaaattactatagacgaaataagctccatgacttcgatgacc
actacagatatattacacacagcaaagacactgaatatcctgcgatattacaagggtcag
catattattttcctgaatgaagatattttagataggtacaatcgacttaaagccaaaaag
agaaggacaatagaccctaatagactcatatggaaaccaccggtatttactgcctctcag
ttacgctttgcctggtaa

DBGET integrated database retrieval system