KEGG   Saccharomyces cerevisiae (budding yeast): YOR249CHelp
Entry
YOR249C           CDS       T00005                                 

Gene name
APC5, RMC1
Definition
anaphase promoting complex subunit 5
Orthology
K03352  
anaphase-promoting complex subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sce04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:complement(798674..800731)
Genome map
AA seq 685 aa AA seqDB search
MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKD
NSNLRSSSIVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEK
NCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVF
KHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGT
LISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQSGLVFDLLDTLSLNDATKFPL
IFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAIN
SFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDAN
IFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNVPSQNFDLFQSLVSYEVKFWKEL
GYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLEL
DYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLS
DVGIRSLPKIIKLIDEYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEF
PFVRKKTDELLESLSVEEDRDVQMT
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtatggtccattgggtattactaactttattactccgtacgatctatgcata
ttaatcctaatacatgctcactgctcacaagataatggcatatcagtgccaacagcagta
tttcttcggttaatatcccctactagaccttcactagaatggaatcctctgctcaaggat
aatagtaatttaagatcttcatctattgttcctcctcctgtacttcctattctagataat
ataataaggatactgttagatgacaaggatggtaacaaaatagctctgacattaatgggc
tatttggaagcaattaatggactggattcaatcaacagactaatgatggatttagaaaag
aactgtttggttaataattacaggtcaatgaaaatgcgtacaacatcaacaagaagacaa
atgacaagagcgagttttttaggaacatttttgtcaacttgtatacgcaagtatcaaatt
ggtgattttgaaatgagggagacaatctggattaatctacaaaatttcaaaactgtattt
aagcatactccgctatggctacgatttaaagataacgttcatattcaaaaggtaaaaaac
tgtcttctggctaacgacgagatctcggtggaggatcaacagatggtggaatttttccaa
cacttcaataatggtaatgacgctgattcaaaaacaatgaacgaagaaaattatgggaca
ttgatttccatccaacatttacaatcaatagttaatcgacaaattgtgaattggttagat
aatacagaatttaatctgatgggtcaagaagaaactagttccacatatgaagaacaaagc
ggactagtttttgatttgctagatacgctttcattgaacgatgccacaaaattccctttg
atttttatattaaagtatctcgaagctataaaagagaacagttatcaaaccgcactagat
tctctacataactattttgattacaagtccacgggcaattctcaaaattacttccatatc
tccttgttgtcccttgccaccttccactcaagtttcaatgagtgtgatgcagcgataaat
tcttttgaggaagccacgagaatcgcaagggaaaataaagatatggaaacgttgaatttg
ataatgatatggataataaacttcatagaggtgcacccggaatatgcaaacagattttat
atcacagtagaacaaataataaaatatctgaaaaatagttcagatgtagaagatgccaat
attttcagtaacgcctacaagtttgaaacattgttatctatggtcaaagaatcgaaaact
gctgaagtttctagttcacttctgaaattcatggctatcactttgcagaacgtgccttct
caaaactttgatcttttccaaagtcttgttagctatgaagtaaaattttggaaagaactg
ggatacgaatccatatccgatgtatatgagaaattcctgtctaaaacatcctcttcctct
ttaaggaactacgactcttctattatcaaccaagatataaaggtagctttcaaggcactt
gaagaagacgattttttaaaagtaaaacaataccttttgaaatcagaatcactggaacta
gactacgaccaaaaaataaatttgaaatatttaagagtgaagtatctcgttaaaataggt
gactatgacctaagcatgcgattaatcaaccaatatgtcaaggagtgctgtgaagaagtg
gcggattcgaactggagattcaaatttgaaattgaaagtatcaatgttttacttttaagt
gacgtagggataagaagtttgccgaagataataaaattaatcgacgaatacaaagagata
ggaaatcctttgcgatgtgtaatattattgcttaaattatgtgaagttttgattcaggta
gggaagagtatggaggcagagtgcttgatcagctgtaacctatcaaccattctagaattc
ccatttgtaaggaagaagacagatgagcttttggaatctcttagtgttgaagaggatagg
gatgttcagatgacttga

DBGET integrated database retrieval system