KEGG   Saccharomyces cerevisiae (budding yeast): YOR278WHelp
Entry
YOR278W           CDS       T00005                                 

Gene name
HEM4, SLU2
Definition
uroporphyrinogen-III synthase HEM4 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YOR278W (HEM4)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YOR278W (HEM4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:842817..843644
Genome map
AA seq 275 aa AA seqDB search
MSSRKKVRVLLLKNKTVPIDKYELECRSKAFEPIFVPLIKHTHVIQDFRNVLNTIPNYLN
TINYIIITSQRTVESLNEAIIPTLTSEQKAALLSKTVYTVGPATANFIRRSGFINVKGGE
DAGNGSILADIIIDDLSTDIKACPPSELLFLVGEIRRDIIPKKLHSKGIKVREVVTYKTE
ELSDGFKRFIHAMKECDEDEVFSDWVVVFSPQGTKEITQYLGDSNRLPGSHLRVASIGPT
TKKYLDDNDVTSDVVSPKPDPKSLLDAIELYQRHK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcgtaaaaaagtcagagtattactgctcaagaataaaactgtccccattgat
aaatatgaattggagtgtaggagtaaggcgtttgaacccatattcgtaccgcttattaaa
catacacatgtaattcaagattttagaaatgttttgaataccatcccaaactatttgaat
actatcaattacattattattacctctcaaaggactgtagagtcattgaatgaagcgatc
attcccacattgacaagtgaacaaaaagctgcattgctcagtaaaacagtttatactgta
ggccctgctactgctaacttcatcagaagatcaggtttcattaatgttaaaggtggagaa
gacgctggtaatggttcaatccttgctgatataattattgatgacttgagtacggatatt
aaggcatgcccaccaagtgaactattatttctcgtgggtgaaattagaagagatatcatc
ccaaagaaactccatagcaagggaataaaagtaagagaagtggttacttataaaactgaa
gaattaagcgacggttttaaaagattcatacacgccatgaaagaatgcgatgaggatgaa
gtattctcggactgggtggtagttttcagtccccagggaacgaaagaaattactcagtat
ttgggtgacagtaaccgcctaccaggttcccatctacgggttgcgtccatcggacctacc
actaaaaaatatctggatgataatgatgtaacctctgatgtggtcagtccaaaaccggac
cccaagtcgctattagatgctattgaattataccagcgccataaataa

DBGET integrated database retrieval system