KEGG   Saccharomyces cerevisiae (budding yeast): YOR288CHelp
Entry
YOR288C           CDS       T00005                                 

Gene name
MPD1
Definition
protein disulfide isomerase MPD1 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YOR288C (MPD1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YOR288C (MPD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(852121..853077)
Genome map
AA seq 318 aa AA seqDB search
MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCG
HCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKP
IDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVL
FSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQR
QSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTG
KKPIKKNHSSSGNKHDEL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcttaatattattaagctccttttgggactttttattatgaatgaagtaaag
gcgcaaaacttttacgattccgatcctcatatatcagagttaacgccaaaaagcttcgat
aaagcgatccataacacaaattacacatcattagtggaattttatgctccgtggtgcggc
cattgtaagaagctctctagtacgttccgcaaggcagcaaaaagattggatggtgtagtc
caagttgctgctgtaaactgtgaccttaacaagaataaggctttgtgtgctaaatacgac
gtaaacggatttcccacgttaatggtatttaggcccccaaaaattgacctatctaagcca
atagataacgccaaaaaaagtttcagcgctcatgccaatgaagtgtactcaggtgcaaga
actctcgcgcctattgttgatttttctctttcaagaataaggtcatatgtcaaaaagttt
gtccgtatagatacacttggctctttacttagaaagtcacccaaactttccgtggtgttg
ttttccaaacaagacaaaatttcaccggtttataaaagcattgcccttgattggttagga
aagttcgatttttattcaatttcaaacaaaaaactcaagcaactaaccgatatgaaccca
acatatgaaaaaactcctgagattttcaaatatttgcagaaggtcattcctgaacagcga
cagagcgataaaagtaagcttgtcgtttttgatgcagacaaagataaattttgggagtat
gaagggaactcaatcaacaaaaatgacatttccaaatttctgcgggacacttttagtatt
acccccaatgagggtccttttagtagacgttctgaatatattgcttacttaaaaactggc
aagaagccaattaaaaagaaccattcctcctcaggaaacaagcacgacgaattgtag

DBGET integrated database retrieval system