KEGG   Saccharomyces cerevisiae (budding yeast): YOR343W-AHelp
Entry
YOR343W-A         CDS       T00005                                 

Definition
gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:970578..971894
Genome map
AA seq 438 aa AA seqDB search
MESQQLHQNPHCPHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQEETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQDQHSEVPQAKTKVRNNVLPPHPHTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YSDILTVLCKSVSKMQTNNQELKDWIALANLEYNGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattacatcaaaatccacattgtccacatggtagcgcctatgcttcg
gttacttctaaggaagtcccatcaaatcaagatccgttagccgtttcagcttccaattta
ccggaatttgatagagattccactaaggttaattctcaagaagagacaacacctgggaca
tcagctgttccagagaaccatcatcatgtctctcctcaacctgcttcagtaccacctcca
cagaatggacagtaccaacagcacggcatgatgaccccaaacaaagctatggcttctaac
tgggcacattaccaacaaccatctatgatgacgtgttcacattatcaaacgtcacctgcg
tattatcaaccggacccacactatccgctgccacagtatatcccaccgctgagtacttcc
tcacctgatccaatcgattcacaggatcaacactctgaagtacctcaagctaagacaaag
gtgagaaataatgtcttaccaccacacccacacacatcagaagaaaacttttctacatgg
gttaaattttacatcagatttttgaagaactctaatctcggtgacattattccaaatgac
cagggtgaaatcaaaagacaaatgacttatgaagaacatgcgtatatatacaataccttc
caagcatttgccccatttcatttattgccaacatgggtaaaacaaattttagaaattaat
tattctgacatccttacagtcctttgtaaaagtgtgtccaaaatgcaaactaacaatcaa
gaattaaaagattggatagctcttgccaaccttgagtacaacggaagtacatctgctgat
acatttgaaattacagtcagcacgatcattcaaaggctaaaagaaaacaatatcaatgtt
agcgacagattggcctgtcaactaatacttaaaggtctatccggtgatttcaaataccta
cgtaatcaatatcgtaccaaaacgaacatgaaactttcccaattattcgctgaaattcaa
ttaatatatgacgaaaataaaatcatgaatctaaataaaccgtcccaatacaaacaacac
agcgaatacaaaaatgtttctcgcacatctccaaacacgactaacacgaaggttacaact
cgtaattatcatagaacaaatagttcaaaaccaagagcagcaaaagctcacaatattgct
acatccagtaaattctcaagggtgaacaatgatcacattaatgaatcaaccgtttcatca
caatacttaagcgatgacaacgaacttagtcttaggccagcaacagaaagaatctaa

DBGET integrated database retrieval system