KEGG   Saccharomyces cerevisiae (budding yeast): YOR361CHelp
Entry
YOR361C           CDS       T00005                                 

Gene name
PRT1, CDC63, DNA26
Definition
Prt1p
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YOR361C (PRT1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     YOR361C (PRT1)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    YOR361C (PRT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XV:complement(1015361..1017652)
Genome map
AA seq 763 aa AA seqDB search
MKNFLPRTLKNIYELYFNNISVHSIVSRNTQLKRSKIIQMTTETFEDIKLEDIPVDDIDF
SDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEAT
GKTKGFLFVECGSMNDAKKIIKSFHGKRLDLKHRLFLYTMKDVERYNSDDFDTEFREPDM
PTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESRENWSTNYVRFSP
KGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFSTEPIIVEEDNEF
SPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHD
ATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTPETNNSACTATIA
EVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNLQICRLTERDIPV
EKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPETKEKTDVIKRWSL
VKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKNINDNNDVSASLK
DVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVKEDIIAGFKNFAW
RPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELLKQWTEYREKI
GQEMEKSMNFKIFDVQPEDASDDFTTIEEIVEEVLEETKEKVE
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttcttccacgcacattgaaaaatatttacgaattatatttcaataacatc
tcagtacatagtatagtatctcgcaacacacagctcaaaaggtcaaagataattcaaatg
actaccgagactttcgaagacattaagctagaggacatccctgttgacgacattgatttt
tccgacctggaagaacaatacaaggtcactgaagaattcaatttcgatcagtacatcgtc
gttaatggtgccccagtcatcccatccgccaaagttcctgttttgaaaaaggctttgact
tctttgttttccaaagctggtaaagttgttaacatggaatttccaattgatgaagccact
ggtaagacgaaaggttttctcttcgtggaatgtggctcaatgaacgatgctaaaaaaatt
atcaagagtttccacggtaaaagactggatttaaaacatcgtttgtttctttatactatg
aaagatgttgaaagatataattctgacgactttgacaccgaattcagggagcctgatatg
cctacattcgttccatctagttccttaaaatcctggttaatggacgacaaagtgagagat
cagtttgtattacaagatgacgtgaagactagtgtgttctggaactctatgttcaatgaa
gaagattctttggtggaatctagagagaactggtctaccaattatgttagattctcccca
aagggtacctatttgttttcttaccatcaacagggtgtaactgcatggggtggtccaaac
ttcgatcgtttgagaagattctatcatccagatgtaagaaactcttccgtctctccgaat
gaaaagtacctggtcactttctccacggaaccaatcattgtagaagaagataacgaattc
tctccatttaccaagaaaaatgagggtcatcaattatgcatctgggacattgcttctggt
ctgttgatggcaactttcccagtgataaagagcccatatctgaaatggcctttagttaga
tggtcttataatgataaatattgtgctcgtatggttggagacagtttaatagttcacgat
gctactaaaaacttcatgccattagaagctaaggctttgaagccttctggtattagagat
ttctcatttgctccagaaggtgttaaattacaaccattcagaaacggtgacgagccttct
gttttattggcttattggactcctgagactaataattccgcttgtactgctaccattgct
gaagttcctcgcggtagagtgctaaaaaccgttaacttagttcaagtctccaacgtaact
ctgcactggcaaaaccaagctgagttcctgtgcttcaatgtcgaacgtcacacaaagtct
ggtaagactcaattcagtaatctacaaatttgtaggttgactgaaagagatataccagtt
gaaaaggttgaattgaaagatagtgtctttgaattcggttgggaaccccacggaaataga
tttgttacaatttctgttcatgaagtagctgatatgaattatgctatcccagcaaataca
atcagattttacgctccagaaactaaagaaaagactgacgtaattaaaagatggagcttg
gtcaaagaaattccaaaaacttttgccaacactgtttcttggtctccagcgggtagattt
gtggttgtaggtgctttagtgggtccaaacatgcgtagatcagacctacaattttacgat
atggactatccaggtgaaaagaatattaatgacaataatgatgtttcagcttctttgaaa
gatgttgctcatcctacctactctgcggctactaatatcacttgggatccatctggtaga
tacgttaccgcatggtcaagttctttgaaacacaaggtggagcatggttacaaaattttc
aatattgctggtaacttagttaaagaagacatcattgctggcttcaagaactttgcctgg
agaccaaggccagcttccattttgtctaacgccgaaaggaaaaaggttaggaaaaacttg
agggaatggtctgcccaattcgaagagcaagatgcaatggaagctgacaccgccatgaga
gatttgattctacaccaacgtgaattattgaagcaatggaccgaatatagagaaaaaatt
ggccaagaaatggaaaaatctatgaatttcaaaatctttgacgttcaaccagaagatgcc
agcgatgactttaccaccatcgaagagatagttgaagaagttttggaagaaacaaaggaa
aaggtcgaataa

DBGET integrated database retrieval system