KEGG   Saccharomyces cerevisiae (budding yeast): YOR368WHelp
Entry
YOR368W           CDS       T00005                                 

Gene name
RAD17
Definition
Rad17p (EC:3.1.11.2)
Orthology
K02830  
cell cycle checkpoint protein [EC:3.1.11.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOR368W (RAD17)
   04113 Meiosis - yeast
    YOR368W (RAD17)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     YOR368W (RAD17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XV:1026843..1028048
Genome map
AA seq 401 aa AA seqDB search
MRINSELANKFSASTVHLEHITTALSCLTPFGSKDDVLIFIDADGLSFVRENNHVIKIQL
LLSRELFMSYSYRNETEDHMKLCVKINHILDSVSVMNRNSDDIVECTLSYDGHGSPFVLI
FEDSFISERVEYSTYLIKDFDTNGLELDRERISFEAIIKGEALHSALKDLKEIGCKECYV
YAKTEANDENVFALISKSQLGFSKIKLPSNRSILEKLQVFDGDSTTVIDGFAVIGFFDFT
SFDKIRKSTKIASKVLFRMDVHGVLSVNILSQTDDVIITDTTRPSNNRPGSIRQLQLPKD
YPGIVIEVCMLEKESIDEAAQTEIELLMETNELGNRNSFKKSTIRKRYGTDKGNETSNDN
LLQLNGKKIKLPSEEENNKNRESEDEENHCKYPTKDIPIFF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcaacagtgagctagcgaacaagttttctgcctcaacggtgcacttagaacat
atcacaactgctttaagttgtttaacaccttttggttctaaagacgatgtgcttatattc
attgatgctgatgggctgtcatttgtcagggagaataatcatgtgataaaaatccaacta
ctgttatctcgggagctatttatgtcttattcgtatagaaatgaaactgaggatcacatg
aaactttgtgtaaaaataaatcatatcttagatagcgttagcgtgatgaacaggaattcg
gatgacattgttgagtgtactttatcttatgatggacatggatcaccatttgtactaata
tttgaagactcgttcatttctgagagagtggagtactctacctacttaattaaggatttt
gatactaatggactagaactcgatagagaaaggataagctttgaggcaattattaagggc
gaagcccttcattcagccttaaaggatctaaaagaaatcggatgcaaagagtgctatgta
tatgcaaagaccgaggcgaatgatgagaatgtatttgccctgatatctaaatctcagcta
ggattttctaaaataaaattacccagtaacagatccatactagagaagttacaagtattt
gacggagattccacaacagtaatagatggttttgctgtaattgggttcttcgatttcacc
tcgtttgataaaatcagaaagagtactaaaattgcaagcaaagtccttttcaggatggat
gttcatggcgtattgagtgtaaatattctaagtcaaacagacgatgtcattatcactgat
actacaagaccttcaaataatcgaccaggtagtattcgccaactgcagctacccaaggat
tatcccggtatagtaattgaggtttgcatgctagaaaaagaatccatagatgaggcagca
cagacagaaatagaactcctgatggagactaatgaacttggcaatcgtaatagttttaaa
aaatcaactataagaaaaagatatggtacagataaaggcaatgaaacttcaaatgacaac
ttgctgcaattgaatgggaaaaaaattaaactaccatctgaagaagaaaacaataaaaac
agggaaagtgaggatgaagagaatcactgcaagtatccaacaaaggatattcctatattt
ttttaa

DBGET integrated database retrieval system