KEGG   Saccharomyces cerevisiae (budding yeast): YPL001WHelp
Entry
YPL001W           CDS       T00005                                 

Gene name
HAT1
Definition
Hat1p (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YPL001W (HAT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:554605..555729
Genome map
AA seq 374 aa AA seqDB search
MSANDFKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDS
VTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDV
FEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLL
NKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAII
QSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSL
KLEERQFNRLVEMLLLLNNSPSFELKVKNRLYIKNYDALDQTDPEKAREALQNSFILVKD
DYRRIIESINKSQG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaatgatttcaagcctgaaacgtggacttcaagcgccaacgaagccttaaga
gtttctatagttggagaaaacgctgttcagttttcaccattattcacgtatccaatttac
ggtgactccgaaaagatctacggctataaggatctcatcatccacctagcatttgattca
gtaacattcaagccgtatgttaacgtcaagtattcagcaaaattaggagacgacaatatt
gtagacgtggaaaaaaaattactctcatttctaccaaaggatgatgtaattgttagggat
gaagctaaatgggtagattgctttgcagaagaacgaaaaacacataatttatctgatgtt
tttgaaaaagtatcagagtattcgttgaatggggaagaatttgttgtatataaatcgagt
ttggttgacgattttgccaggagaatgcatcgtcgtgttcaaatcttttcattacttttt
atcgaagccgctaactatatagatgagactgacccgagttggcaaatctattggttgttg
aacaagaaaacaaaagaattgattggtttcgtcactacttacaagtattggcactacctt
ggagcaaaatctttcgatgaggatatagataaaaaattcagagccaaaatatctcaattt
ctgatctttccaccttatcaaaataaaggccacggatcctgtctttatgaggctataatc
caatcttggctagaagacaaaagtattactgaaattactgtagaggatccaaacgaagca
tttgacgatcttcgcgacaggaatgatattcaaagactgcgaaaacttggttatgatgct
gtctttcagaagcactccgacctttctgatgagtttttggagtcaagccgaaaatcttta
aaactggaagaaagacagtttaatcgtcttgtggaaatgcttcttcttttaaacaattct
ccatcatttgaattaaaggtaaagaataggttgtacattaaaaattatgatgccctagat
caaactgatccagaaaaggcaagagaagctttacaaaattcatttattttagtcaaagat
gattataggcgtattatagagtcgataaataaatctcaaggttaa

DBGET integrated database retrieval system