KEGG   Saccharomyces cerevisiae (budding yeast): YPL031CHelp
Entry
YPL031C           CDS       T00005                                 

Gene name
PHO85, LDB15
Definition
cyclin-dependent serine/threonine-protein kinase PHO85 (EC:2.7.11.22)
Orthology
K06655  
negative regulator of the PHO system [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPL031C (PHO85)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YPL031C (PHO85)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:complement(join(492018..492918,493021..493037))
Genome map
AA seq 305 aa AA seqDB search
MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKEL
KHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG
LAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVL
MGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLP
KYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEY
YHHAS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcttcacaatttaagcagttagaaaagcttggcaatggtacgtatgccaca
gtgtacaagggactgaacaaaaccacaggggtatatgttgccctgaaagaggtaaaactg
gattcagaggaaggtacaccctctacggccatccgtgagatctccctaatgaaagaattg
aaacatgagaacattgttagactttatgacgttattcacacagagaacaagttgactttg
gtttttgaattcatggacaacgatttaaagaaatacatggattcccgcaccgtgggcaac
acaccaagagggctagaactaaacttggttaaatacttccagtggcaactactgcaaggg
ctggccttttgccatgaaaacaagattctccaccgtgatttaaaacctcaaaacctatta
atcaacaagagaggccagttgaaattgggtgatttcggtctggcccgtgctttcggtatt
ccggtcaacacattttcaagcgaagtcgtaacgttgtggtaccgtgctcctgatgtgcta
atgggttctaggacgtactccacatccattgatatatggtcgtgtgggtgcattcttgcg
gaaatgataacgggtaagcctttgtttcctggcaccaacgacgaagaacaactgaaattg
atcttcgacatcatgggcactcctaatgagtccctatggcccagtgtaacaaagttaccc
aaatacaacccaaatatccagcaacgaccaccaagagacctacgtcaagtattgcaacca
cacaccaaagaaccgctagacgggaatctcatggatttcttacacggactcttgcaactt
aatccggatatgaggctgagcgccaagcaggctctgcatcacccttggtttgcagagtac
taccaccacgcttcataa

DBGET integrated database retrieval system