KEGG   Saccharomyces cerevisiae (budding yeast): YPL042CHelp
Entry
YPL042C           CDS       T00005                                 

Gene name
SSN3, CDK8, GIG2, NUT7, RYE5, SRB10, UME5
Definition
Ssn3p (EC:2.7.11.23 2.7.11.22)
Orthology
K02208  
cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YPL042C (SSN3)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     YPL042C (SSN3)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   YPL042C (SSN3)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     YPL042C (SSN3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(473040..474707)
Genome map
AA seq 555 aa AA seqDB search
MYNGKDRAQNSYQPMYQRPMQVQGQQQAQSFVGKKNTIGSVHGKAPMLMANNDVFTIGPY
RARKDRMRVSVLEKYEVIGYIAAGTYGKVYKAKRQINSGTNSANGSSLNGTNAKIPQFDS
TQPKSSSSMDMQANTNALRRNLLKDEGVTPGRIRTTREDVSPHYNSQKQTLIKKPLTVFY
AIKKFKTEKDGVEQLHYTGISQSACREMALCRELHNKHLTTLVEIFLERKCVHMVYEYAE
HDLLQIIHFHSHPEKRMIPPRMVRSIMWQLLDGVSYLHQNWVLHRDLKPANIMVTIDGCV
KIGDLGLARKFHNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAVDLWSVGCIFAELIG
LQPIFKGEEAKLDSKKTVPFQVNQLQRILEVLGTPDQKIWPYLEKYPEYDQITKFPKYRD
NLATWYHSAGGRDKHALSLLYHLLNYDPIKRIDAFNALEHKYFTESDIPVSENVFEGLTY
KYPARRIHTNDNDIMNLGSRTKNNTQASGITAGAAANALGGLGVNRRILAAAAAAAAAVS
GNNASDEPSRKKNRR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtataatggcaaggatagagcacaaaactcctatcagccaatgtaccaaaggcctatg
caggtacaaggacaacagcaagctcaatcgttcgttggaaagaaaaacacaatcggaagt
gtgcatggaaaagccccgatgctaatggccaataatgatgtttttactattggaccttat
agggcaagaaaagatagaatgcgggtatctgtcttagaaaagtacgaagttattggctac
attgctgcgggcacatatggtaaagtttacaaagcgaaaagacaaatcaactccggtacc
aattccgctaatggttctagtctgaatggtaccaatgcgaaaattccgcagtttgacagc
acgcaaccaaaatcaagctcttcaatggacatgcaggcaaatacaaacgcattaagaaga
aacttgttaaaggatgaaggagtgacccccggaagaatacgaactacgagggaagatgta
tccccgcactataattcccaaaaacaaaccctcattaaaaaaccgctgacggtattttat
gccattaaaaagttcaagacagagaaggatggcgtcgaacaattgcattatacgggaata
tctcagagtgcctgtagagaaatggcattatgtcgagaattgcacaacaagcatttaacc
acattagtggaaatttttttggaaaggaaatgtgtccatatggtatacgaatatgcggag
catgatctgctacaaattatccacttccattcccatcccgaaaaaaggatgataccacca
agaatggttcggtctattatgtggcagcttttagacggcgtatcgtatcttcatcaaaat
tgggtgcttcatcgagatttgaaacccgcaaatataatggtgaccatagatggatgtgtt
aaaattggtgatttaggtttggccagaaaatttcataatatgctgcaaaccctctatact
ggggataaagtggttgtcactatatggtaccgtgcacctgagttgctattgggagcacgg
cactatacccctgcggttgatttatggtccgttggctgcatttttgcagaactgatagga
ttacagcccatatttaaaggtgaagaagctaaactagactctaaaaagactgttccattt
caagtgaatcaactacagagaattttggaagttcttggcactcccgatcaaaaaatttgg
ccttatttggagaagtatccagaatatgatcaaattacgaagtttccaaagtatagggat
aaccttgctacatggtatcattccgcgggaggaagggacaagcatgctttaagcttactt
taccacttgttaaattatgatccaattaaaagaatagatgcatttaatgcgttggaacat
aagtacttcacagaaagtgatattcctgttagtgaaaatgtatttgaaggtctaacttac
aaatacccggcaagaagaattcacacgaacgataatgacatcatgaatcttggatcaaga
acgaaaaacaatacacaagcttcaggaatcaccgcaggtgccgctgcaaatgcgttaggt
gggcttggtgttaaccgtagaattctggccgcggcagcagcagccgctgctgcggtgtca
ggaaacaatgcatcagatgagccatctcgaaagaaaaacagaagatag

DBGET integrated database retrieval system