KEGG   Saccharomyces cerevisiae (budding yeast): YPL072WHelp
Entry
YPL072W           CDS       T00005                                 

Gene name
UBP16
Definition
Ubp16p (EC:3.4.19.12)
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YPL072W (UBP16)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YPL072W (UBP16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:418512..420011
Genome map
AA seq 499 aa AA seqDB search
MSWIKNVTESPTSLIKKVSCGLIIAASLYAIAPSLSALVFGDSKQSIGKYTTVGLINRGN
DCFITSSLQGLAGIPRFVEYLKRIRTVLLELETKLSNNAKGDNPTVDNTTRHSRLENSSN
SLAPLHESLTSLILDLISVKDRKTSISPKIVINTLESIFKSKISSKQNDAHEFTLILLQT
LQEERSKLIDYSKQICNLNIPKFPFEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQT
SENLSNILAHDETEIIDDYSCLICQIRAILNHEEYRNFKDCTPDEILMLDRLKNYATKAP
INENLPFEVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRN
PCNVKFGERITLSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHYMCYRRKTEIRFG
KEDESSFRRAPVVNNEVNKNREQNVAHNDYKKSRYKKVKNALRYPYWQISDTAIKESTAS
TVLNEQKYAYMLYYERVNK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggataaaaaatgtaacagaatctccgacttcactgattaaaaaagtttcatgt
ggtttgataattgctgcttctctatatgccattgcacccagcctaagtgcgctagtcttt
ggggattctaagcagagtattgggaagtacacgacagtgggcttaattaatcgtgggaat
gattgcttcataacatcatctttgcaaggcctggctggaatacctcgatttgtagaatat
ttgaaacggataagaacggtccttctagaattagaaactaagctgtcaaataatgcaaaa
ggcgacaatcctacagttgataacactacaaggcatagtcgacttgaaaactcgtctaat
tcacttgcccccttacacgaaagtcttaccagtttaattttggatttgatatctgtaaaa
gatcgtaagacgtcaatttctccgaaaatagtgataaacacattagagtccatctttaaa
tcaaagatctcatccaaacaaaatgatgcacatgaatttacattaatattactacaaaca
ttacaggaagaacgatcaaaattgatcgattacagtaaacagatatgtaatttgaatata
ccaaagtttccatttgagggcgagacttccaagtttctagtatgccttaaatgcaagggt
ctatcagaaccatcatacaaacagactttcatccgcgaactgtccgtaccacaacaaaca
tcagagaatctatccaatattctagcacacgatgaaacagaaatcatagacgactattca
tgcctgatctgccaaataagagcaatcttaaaccatgaagaatatagaaatttcaaggac
tgtaccccggatgaaattttaatgttggacagattgaaaaattatgccactaaagcccca
attaacgaaaatttaccattcgaagtagaacagtacgtcaagcgttactcaaagggcaat
ttgcaggtatctaatataaagggaaaggtcatcaaaaaagatgtagtagtacaactgcca
gacatattaattgttcacttatcgagatccacattcaatggtattacatattctagaaat
ccctgcaatgtcaaatttggagaaagaataacactttctgaatatacattggctgagagt
gggacaataacagaaaacaggcaagtcaaatataatttgaaaagtgttgtgaaacacacc
ggttctcattcgagtggacactatatgtgttacagacgcaagactgaaattcgtttcggg
aaggaggatgaatcttccttcagaagagcaccagttgtcaacaatgaagttaacaagaat
cgcgagcaaaacgttgcacataatgattacaaaaaaagcagatataaaaaagtcaaaaac
gccctgcggtatccttattggcaaatatctgataccgccataaaggaatctaccgcttca
actgtcttgaatgaacagaaatatgcttatatgctatactacgaacgtgtaaataaataa

DBGET integrated database retrieval system