KEGG   Saccharomyces cerevisiae (budding yeast): YPL086CHelp
Entry
YPL086C           CDS       T00005                                 

Gene name
ELP3, HPA1, KTI8, TOT3
Definition
Elongator subunit ELP3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YPL086C (ELP3)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    YPL086C (ELP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(384773..386446)
Genome map
AA seq 557 aa AA seqDB search
MARHGKGPKTNKKKLAPEKERFIQCCADITLELTDSLTSGTTREINLNGLITKYSKKYKL
KQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMG
GTFMSLPKEYREDFIVKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCTQTH
LDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPN
VGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVAR
ILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTTCRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRNY
YGKLGYELDGPYMSKRI
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcatggaaaaggcccaaaaactaacaaaaaaaagctagcacctgaaaaggaa
aggtttatacaatgttgtgctgatatcacattagagttaacagattctttaacctcggga
acaacaagagaaattaatctgaatggtttgattactaaatattcaaagaaatataaacta
aagcaacaaccaaggttaaccgatatcattaattctattccagaccaatacaaaaaatat
ttattacccaaattgaaggctaagccagtaagaacagcatcgggtattgcagtggtagcc
gttatgtgtaaaccacatcgttgtcctcacattgcatatacaggtaatatttgtgtttat
tgtccaggtggtccagattcagattttgagtattctacacaatcttacacaggctatgaa
ccaacttcaatgcgtgccatcagagctcgttatgacccttatgaacaagcacgtggtagg
gtggaacaattgaaacagttaggtcactccatcgataaagtcgaatatgttctgatgggt
ggtacatttatgtcattaccaaaagaatatcgtgaagattttattgtgaaattgcataat
gcactttctgggttcaatggtaatgatattgatgaagctattctttattcgcaacaaagt
ttaacgaagtgtgttggtataacaatcgaaactaggcctgattattgtacgcaaacacat
ttggacgatatgttaaaatatggctgtaccagattagaaattggtgttcagtccttgtac
gaagacgttgctcgtgatactaatagaggacacaccgttaggtctgtttgtgaaactttt
gctgtgtctaaagatgctggttataaggttgtttctcacatgatgccagatttaccaaat
gttgggatggaaagagatattgaacagttcaaagagtattttgaaaatcctgattttagg
actgatgggttgaaaatctatccaactttagtcattaggggtacaggtttatacgaactt
tggaaaacgggcaggtataagtcttatagtgccaacgccttagtggacttagttgctaga
atcttggccctagtgcccccatggacaagaatctaccgtgtccaaagagacattccaatg
cccttggttacctcaggtgttgacaatggtaacttgagagaattggcattagctagaatg
aaggacttgggtacaacttgtagggatgttcgtactagggaagtgggtatccaagaagtg
catcataaagttcaaccagatcaggtcgagcttatcagaagggattactatgcaaatggt
ggttgggaaacctttttatcatatgaagatccaaagaaagatatactgattggtttgctg
agattgagaaaggcttcaaagaaatatacatatagaaaagaattcacctcccagaggact
tctattgttagagaattgcatgtttatggttctgtggttccacttcattcaagagatcct
cgtaaattccagcatcaagggtttggtactctattgatggaagaagcggaaagaatcgcc
aaggaagagcatggttcagagaaaatttctgttatttctggtgttggtgtaagaaattac
tatggtaaactaggatatgaactagacggtccatacatgtcgaaaagaatttaa

DBGET integrated database retrieval system