KEGG   Saccharomyces cerevisiae (budding yeast): YPL111WHelp
Entry
YPL111W           CDS       T00005                                 

Gene name
CAR1, LPH15
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPL111W (CAR1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YPL111W (CAR1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     YPL111W (CAR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:339944..340945
Genome map
AA seq 333 aa AA seqDB search
METGPHYNYYKNRELSIVLAPFSGGQGKLGVEKGPKYMLKHGLQTSIEDLGWSTELEPSM
DEAQFVGKLKMEKDSTTGGSSVMIDGVKAKRADLVGEATKLVYNSVSKVVQANRFPLTLG
GDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHC
PESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKA
VHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVV
ECNPDLAIHDIHVSNTISAGCAIARCALGETLL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctcattacaactactacaaaaatcgcgaattgtccatcgttctggct
ccattcagcggcggtcagggtaagcttggtgtcgagaagggccctaaatacatgcttaag
catggtctgcaaacaagcatagaggatttgggctggtctacggaattagagccctcaatg
gacgaggcccaatttgtgggaaagttgaaaatggagaaggactccacaactgggggttcc
tctgttatgatagacggtgtcaaggctaaaagagcagatttggttggtgaagccaccaag
ttggtgtacaactccgtgtcgaaagtggtccaggcgaacagattccccttgaccttgggt
ggtgatcattcaatagccattggtactgtatccgcggttttggacaaataccccgatgct
ggtcttttatggatagacgcccacgctgatataaacaccatagaaagcaccccctctgga
aacttgcacggctgtcccgtgtcattcctaatgggtttgaacaaggatgtcccacattgt
cccgagtcgctcaaatgggttccaggcaacttgagcccaaaaaagatcgcgtatattggg
ttgagagatgttgatgccggagaaaagaaaatcttgaaagatctgggtatcgccgccttt
tccatgtaccacgttgacaaatacggcatcaacgctgtcattgaaatggcaatgaaagcc
gtgcacccagaaacaaacggtgaaggtcccattatgtgctcctatgacgtcgatggtgta
gacccattatacattcctgctacaggtactccagtgagaggtgggttgaccttgagagaa
ggtcttttcttggtggaaagattggccgaatccggtaatttaattgcgctagacgttgtt
gaatgtaaccctgatctggctattcatgatatccatgtttcaaacaccatctctgcaggt
tgcgccattgcaaggtgtgcattgggtgaaaccttattgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system