KEGG   Saccharomyces cerevisiae (budding yeast): YPL111WHelp
Entry
YPL111W           CDS       T00005                                 

Gene name
CAR1, LPH15
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sce01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sce00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:339944..340945
Genome map
AA seq 333 aa AA seqDB search
METGPHYNYYKNRELSIVLAPFSGGQGKLGVEKGPKYMLKHGLQTSIEDLGWSTELEPSM
DEAQFVGKLKMEKDSTTGGSSVMIDGVKAKRADLVGEATKLVYNSVSKVVQANRFPLTLG
GDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHC
PESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKA
VHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVV
ECNPDLAIHDIHVSNTISAGCAIARCALGETLL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctcattacaactactacaaaaatcgcgaattgtccatcgttctggct
ccattcagcggcggtcagggtaagcttggtgtcgagaagggccctaaatacatgcttaag
catggtctgcaaacaagcatagaggatttgggctggtctacggaattagagccctcaatg
gacgaggcccaatttgtgggaaagttgaaaatggagaaggactccacaactgggggttcc
tctgttatgatagacggtgtcaaggctaaaagagcagatttggttggtgaagccaccaag
ttggtgtacaactccgtgtcgaaagtggtccaggcgaacagattccccttgaccttgggt
ggtgatcattcaatagccattggtactgtatccgcggttttggacaaataccccgatgct
ggtcttttatggatagacgcccacgctgatataaacaccatagaaagcaccccctctgga
aacttgcacggctgtcccgtgtcattcctaatgggtttgaacaaggatgtcccacattgt
cccgagtcgctcaaatgggttccaggcaacttgagcccaaaaaagatcgcgtatattggg
ttgagagatgttgatgccggagaaaagaaaatcttgaaagatctgggtatcgccgccttt
tccatgtaccacgttgacaaatacggcatcaacgctgtcattgaaatggcaatgaaagcc
gtgcacccagaaacaaacggtgaaggtcccattatgtgctcctatgacgtcgatggtgta
gacccattatacattcctgctacaggtactccagtgagaggtgggttgaccttgagagaa
ggtcttttcttggtggaaagattggccgaatccggtaatttaattgcgctagacgttgtt
gaatgtaaccctgatctggctattcatgatatccatgtttcaaacaccatctctgcaggt
tgcgccattgcaaggtgtgcattgggtgaaaccttattgtag

DBGET integrated database retrieval system