KEGG   Saccharomyces cerevisiae (budding yeast): YPL122CHelp
Entry
YPL122C           CDS       T00005                                 

Gene name
TFB2
Definition
Tfb2p
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YPL122C (TFB2)
  Replication and repair
   03420 Nucleotide excision repair
    YPL122C (TFB2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YPL122C (TFB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:complement(319226..320767)
Genome map
AA seq 513 aa AA seqDB search
MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLL
DLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALTGGEVQNS
FGVVVEENVVSLDLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTG
EFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKID
ALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNR
EEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVL
SLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKL
ELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGV
LLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactattccctgaagcattcggtcactcagtatttggaagaaattcctcaacaa
gttcaaaataggctttatacctcaccagctacatgtctggctatctatagaattttacca
ccactagctaaattttttatcatggcaatggttttcaacgaaaatgaagtacctttgttg
gatttagataaatgggttaactctaatggtaaattgcagtttcagaatgcaatcaaatcg
atgaagtctttgcatcttcttataccaaataaatcatctggtactttgatgatcaaccta
aacccaacattcaaaatcagcctgaggaacgcattaacgggtggggaagttcaaaactca
ttcggtgtggttgtagaggaaaacgtagttagcctggacttgttggatgaatattcagct
aataaatgggaaacaatattacatttcatggttggcactcccctcgctaaaatcccatct
gaaaaagtactgaaccttttaaaacacagtaaactaatggaagaggtaaactctactgga
gagttcaaaatcactaatgaaggcttccaatttcttttacaagaaatcaactcccaatta
tggacattattattgcaatatttaaaaatgatcgaaacgtccaaaatggatttagtcgat
gttttacattttattttcatgttaggcgcattggaagttggcaaagcctataaaatcgat
gcattaagcgaaacacaaagaattatgttacaagatatgcgagactatggtttggtattc
cagaagcattcaaatgatagcattttttatccaacaaaattagctttgatgctgacttcc
gataccaagacaatcagatctgcctccaatgcgatggatagtgtactgagacagaataga
gaagagccgtcagtaaatgaagacggcgccaacgggaaatccacaacagatatcactaca
tcagatgatttgaacaaagcaggtctaaaaaatcaagatatacccgatggctcattgatt
gtagaaacaaatttcaaaatctattcatattctaattcacctctgcaaattgctgttttg
tctctttttgttcatttaaaggcaagatttgtgaatatggtattgggtcaaataacaagg
gaatccataagaagagcattgaccaatggtatcactgccgaccaaatcattgcctatctg
gagacacatgcacatcctcaaatgagaaggttggcagaagagaaactagaaaaaaaatta
gagctggaccccaactgtaaggagcctttacaagttttgcctcctaccgtcgtagatcaa
atcagattatggcaattagagttagatagagtcattacatatgaaggttccttatattct
gattttgagactagtcaagaatacaacttactaagtaagtacgctcaagatatcggtgtt
ttgttgtggaaagacgacaaaaagaagaaatttttcatctcaaaggaaggtaattctcaa
gtacttgatttcgctaaaagaaagttgaaaaagaaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system