KEGG   Saccharomyces cerevisiae (budding yeast): YPL122CHelp
Entry
YPL122C           CDS       T00005                                 

Gene name
TFB2
Definition
(RefSeq) TFIIH/NER complex subunit TFB2
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Module
sce_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YPL122C (TFB2)
  Replication and repair
   03420 Nucleotide excision repair
    YPL122C (TFB2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YPL122C (TFB2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YPL122C (TFB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 855981
NCBI-ProteinID: NP_015203
SGD: S000006043
UniProt: Q02939
Structure
PDB: 

Jmol
Position
XVI:complement(319226..320767)
Genome map
AA seq 513 aa AA seqDB search
MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLL
DLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALTGGEVQNS
FGVVVEENVVSLDLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTG
EFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKID
ALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNR
EEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVL
SLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKL
ELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGV
LLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactattccctgaagcattcggtcactcagtatttggaagaaattcctcaacaa
gttcaaaataggctttatacctcaccagctacatgtctggctatctatagaattttacca
ccactagctaaattttttatcatggcaatggttttcaacgaaaatgaagtacctttgttg
gatttagataaatgggttaactctaatggtaaattgcagtttcagaatgcaatcaaatcg
atgaagtctttgcatcttcttataccaaataaatcatctggtactttgatgatcaaccta
aacccaacattcaaaatcagcctgaggaacgcattaacgggtggggaagttcaaaactca
ttcggtgtggttgtagaggaaaacgtagttagcctggacttgttggatgaatattcagct
aataaatgggaaacaatattacatttcatggttggcactcccctcgctaaaatcccatct
gaaaaagtactgaaccttttaaaacacagtaaactaatggaagaggtaaactctactgga
gagttcaaaatcactaatgaaggcttccaatttcttttacaagaaatcaactcccaatta
tggacattattattgcaatatttaaaaatgatcgaaacgtccaaaatggatttagtcgat
gttttacattttattttcatgttaggcgcattggaagttggcaaagcctataaaatcgat
gcattaagcgaaacacaaagaattatgttacaagatatgcgagactatggtttggtattc
cagaagcattcaaatgatagcattttttatccaacaaaattagctttgatgctgacttcc
gataccaagacaatcagatctgcctccaatgcgatggatagtgtactgagacagaataga
gaagagccgtcagtaaatgaagacggcgccaacgggaaatccacaacagatatcactaca
tcagatgatttgaacaaagcaggtctaaaaaatcaagatatacccgatggctcattgatt
gtagaaacaaatttcaaaatctattcatattctaattcacctctgcaaattgctgttttg
tctctttttgttcatttaaaggcaagatttgtgaatatggtattgggtcaaataacaagg
gaatccataagaagagcattgaccaatggtatcactgccgaccaaatcattgcctatctg
gagacacatgcacatcctcaaatgagaaggttggcagaagagaaactagaaaaaaaatta
gagctggaccccaactgtaaggagcctttacaagttttgcctcctaccgtcgtagatcaa
atcagattatggcaattagagttagatagagtcattacatatgaaggttccttatattct
gattttgagactagtcaagaatacaacttactaagtaagtacgctcaagatatcggtgtt
ttgttgtggaaagacgacaaaaagaagaaatttttcatctcaaaggaaggtaattctcaa
gtacttgatttcgctaaaagaaagttgaaaaagaaacaataa

DBGET integrated database retrieval system