KEGG   Saccharomyces cerevisiae (budding yeast): YPL153CHelp
Entry
YPL153C           CDS       T00005                                 

Gene name
RAD53, LSD1, MEC2, SPK1
Definition
Rad53p (EC:2.7.12.1 2.7.11.1)
Orthology
K02831  
ser/thr/tyr protein kinase RAD53 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPL153C (RAD53)
   04113 Meiosis - yeast
    YPL153C (RAD53)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YPL153C (RAD53)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:complement(261727..264192)
Genome map
AA seq 821 aa AA seqDB search
MENITQPTQQSTQATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKR
SIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNS
NQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIRSNLKNTSKIASPGLTS
STASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG
VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREIS
RQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLA
YVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQI
GRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLGSQSYGDFS
QISLSQSLSQQKLLENMDDAQYEFVKAQRKLQMEQQLQEQDQEDQDGKIQGFKIPAHAPI
RYTQPKSIEAETREQKLLHSNNTENVKSSKKKGNGRFLTLKPLPDSIIQESLEIQQGVNP
FFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLN
NNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQT
AEEKDLVKKLTQMMAAQRANQPSASSSSMSAKKPPVSDTNNNGNNSVLNDLVESPINANT
GNILKRIHSVSLSQSQIDPSKKVKRAKLDQTSKGPENLQFS
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatattacacaacccacacagcaatccacgcaggctactcaaaggtttttgatt
gagaagttttctcaagaacagatcggcgaaaacattgtgtgcagggtcatttgtaccacg
ggtcaaattcccatccgagatttgtcagctgatatttcacaagtgcttaaggaaaaacga
tccataaagaaagtttggacatttggtagaaacccagcctgtgactatcatttaggaaac
atttcaagactgtcaaataagcatttccaaatactactaggagaagacggtaacctttta
ttgaatgacatttccactaatgggacctggttaaatgggcaaaaagtcgagaagaacagc
aatcagttactgtctcaaggtgatgaaataaccgttggtgtaggcgtggaatcagatatt
ttatctctggtcattttcataaacgacaaatttaagcagtgcctcgagcagaacaaagtt
gatcgcataagatctaacctgaaaaatacctctaaaatagcttctcctggtcttacatca
tctactgcatcatcaatggtggccaacaagactggtatttttaaggatttttcgattatt
gacgaagtggtgggccagggtgcatttgccacagtaaagaaagccattgaaagaactact
gggaaaacattcgcggtgaagattataagtaaacgcaaagtaataggcaatatggatggt
gtgacaagagagttagaagtattgcaaaagctcaatcatccaaggatagtacgattgaaa
ggattttatgaagatactgagagttattatatggtgatggagttcgtttctggtggtgac
ttaatggattttgttgctgctcatggtgcggttggagaagatgctgggagggagatatcc
aggcagatactcacagcaataaaatacattcactctatgggcatcagccatcgtgaccta
aagcccgataatattcttattgaacaagacgatcctgtattggtaaagataaccgacttt
ggtctggcaaaagtacaaggaaatgggtcttttatgaaaaccttctgtggcactttggca
tatgtggcacctgaagtcatcagaggtaaagatacatccgtatctcctgatgaatacgaa
gaaaggaatgagtactcttcgttagtggatatgtggtcaatgggatgtcttgtgtatgtt
atcctaacgggccacttaccttttagtggtagcacacaggaccaattatataaacagatt
ggaagaggctcatatcatgaagggcccctcaaagatttccggatatctgaagaagcaaga
gatttcatagattcattgttacaggtggatccaaataataggtcgacagctgcaaaagcc
ttgaatcatccctggatcaagatgagtccattgggctcacaatcatatggtgatttttca
caaatatccttatcacaatcgttgtcgcagcagaaattattagaaaatatggacgatgct
caatacgaatttgtcaaagcgcaaaggaaattacaaatggagcaacaacttcaagaacag
gatcaggaagaccaagatggaaaaattcaaggatttaaaatacccgcacacgcccctatt
cgatatacacagcccaaaagcattgaagcagaaactagagaacaaaaacttttacattcc
aataatactgagaatgtcaagagctcaaagaaaaagggtaatggtaggtttttaacttta
aaaccattgcctgacagcattattcaagaaagcctggagattcagcaaggtgtgaatcca
tttttcattggtagatccgaggattgcaattgtaaaattgaagacaataggttgtctcga
gttcattgcttcattttcaaaaagaggcatgctgtaggcaaaagcatgtatgaatctccg
gcacaaggtttagatgatatttggtattgccacaccggaactaacgtgagctatttaaat
aataaccgcatgatacagggtacgaaattccttttacaagacggagatgaaatcaagatc
atttgggataaaaacaataaatttgtcattggctttaaagtggaaattaacgatactaca
ggtctgtttaacgagggattaggtatgttacaagaacaaagagtagtacttaagcaaaca
gccgaagaaaaagatttggtgaaaaagttaacccagatgatggcagctcaacgtgcaaat
caaccctcggcttcttcttcatcaatgtcggctaagaagccgccagttagcgatacaaat
aataacggcaataattcggtactaaacgacttggtagagtcaccgattaatgcgaatacg
gggaacattttgaagagaatacattcggtaagtttatcgcaatcacaaattgatcctagt
aagaaggttaaaagggcaaaattggaccaaacctcaaaaggccccgagaatttgcaattt
tcgtaa

DBGET integrated database retrieval system