KEGG   Saccharomyces cerevisiae (budding yeast): YPL194WHelp
Entry
YPL194W           CDS       T00005                                 

Gene name
DDC1
Definition
Ddc1p
Orthology
K06663  
DNA damage checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPL194W (DDC1)
   04113 Meiosis - yeast
    YPL194W (DDC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:179277..181115
Genome map
AA seq 612 aa AA seqDB search
MSFKATITESGKQNIWFRAIYVLSTIQDDIKITVTTNELIAWSMNETDTTLCQVRFQKSF
FEEYEFKPHEIVFGENGVQVIEDTYGNSHKLYSFRVNGRHLTTISRKPDGDGIKSFTIAV
NNTSTCPESLANRLIVVIEMDSLIVKEYCPQFQPIKYDPIIINLKYKRRFLDVFGTAASD
RNPQEPLDPKLLDVFTNTERELTSALFNEEVESDIRKRNQLTAADEINYICCNSTLLKNF
LDNCNVNVTDEVKLEINVHRLSITAFTKAVYGKNNDLLRNALSMSNTISTLDLEHYCLFT
TIEDEKQDKRSHSKRREHMKSIIFKLKDFKNFITIGPSWKTTQDGNDNISLWFCHPGDPI
LMQMQKPGVKLELVEVTDSNINDDILEGKFIKTAISGSKEEAGLKDNKESCESPLKSKTA
LKRENLPHSVAGTRNSPLKVSYLTPDNGSTVAKTYRNNTARKLFVEEQSQSTNYEQDKRF
RQASSVHMNMNREQSFDIGTTHEVACPRNESNSLKRSIADICNETEDPTQQSTFAKRADT
TVTWGKALPAADDEVSCSNIDRKGMLKKEKLKHMQGLLNSQNDTSNHKKQDNKEMEDGLG
LTQVEKPRGIFD
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaggcaactatcaccgagtcggggaagcagaatatctggtttcgtgcgata
tatgtgttatctacaattcaggatgatatcaagattacagtgacaacaaatgagttaatt
gcttggtcaatgaacgagacagatactactctttgtcaggttaggtttcagaaaagcttt
tttgaggagtatgagtttaaaccacatgagattgtatttggagaaaatggggttcaagtt
atagaagatacgtacggcaatagtcataagttatactccttccgtgttaatggaagacac
ctaacaactatatcaagaaagccggatggtgatggcatcaaatcattcacaattgcggta
aacaacacttctacctgtcctgaatcacttgcaaatagattgattgtggtgattgaaatg
gattcgttaatagtcaaagaatactgtccccaattccagccaataaaatacgatcccata
ataatcaaccttaagtacaaaaggaggtttttggatgtttttggaactgctgcctccgat
cggaatccacaggagcccttggaccctaagctattggacgtttttacaaatacagagcgt
gagctaacatcagccttatttaacgaagaagtggaatcagacatacgtaaaaggaatcag
ttaacggctgctgatgagattaattacatttgttgtaattcaactttattgaagaatttt
ttagacaactgcaatgttaatgtaaccgatgaagtaaaattggaaattaacgtacatagg
ctaagcataactgcattcaccaaggccgtctacggcaaaaataacgaccttttaagaaat
gcgttaagcatgagtaacactatcagtacgctcgatcttgagcattattgcttatttaca
acaatcgaagatgaaaaacaagataagcgatcacatagtaagcgtagagagcatatgaaa
agtataatattcaaattgaaggacttcaaaaacttcataacgataggtccatcctggaag
actacccaggacggaaatgataatataagtttatggttttgccacccaggggaccctatt
cttatgcaaatgcaaaaaccgggcgtaaaattagaattggttgaagttactgacagtaac
attaacgatgatattttagaaggaaaattcataaaaacagcaatctctggctccaaagaa
gaggccggactgaaagacaacaaagaaagctgcgaaagtccattaaaaagcaaaactgct
ttaaagagagaaaacctgccacactctgtggctggaactcgaaacagtcctttgaaagtg
tcgtatctgacccctgataatggaagcacagttgctaagacctatagaaataacacggca
agaaaattattcgtggaagaacaaagccaaagtacgaattacgaacaagataagcggttc
cggcaggctagttcagttcatatgaacatgaatcgggaacaaagttttgacattggtacg
actcatgaagtggcctgtccacgtaatgagagcaattctttaaaaagatccatagcagat
atttgtaatgaaactgaagaccccacccaacaatctacatttgcaaaaagggcagacacc
actgtgacatggggaaaagcgttaccagctgcagatgatgaggtttcatgcagcaatatc
gatagaaaaggaatgctcaagaaagaaaaattgaagcatatgcaaggtctgttgaattcc
cagaatgacacaagtaatcacaagaaacaggacaataaagagatggaagatgggctgggt
ctaacacaagtagaaaagccaaggggtatatttgactaa

DBGET integrated database retrieval system