KEGG   Saccharomyces cerevisiae (budding yeast): YPL203WHelp
Entry
YPL203W           CDS       T00005                                 

Gene name
TPK2, PKA2, PKA3, YKR1
Definition
cAMP-dependent protein kinase catalytic subunit TPK2 (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YPL203W (TPK2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YPL203W (TPK2)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YPL203W (TPK2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YPL203W (TPK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:166256..167398
Genome map
AA seq 380 aa AA seqDB search
MEFVAERAQPVGQTIQQQNVNTYGQGVLQPHHDLQQRQQQQQQRQHQQLLTSQLPQKSLV
SKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERR
MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA
LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTK
PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLI
TADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPE
EQLDYGIQGDDPYAEYFQDF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgttgcagaaagggctcagccagttggtcaaacaatccagcagcaaaatgtt
aatacttacgggcaaggcgtcctacaaccgcatcatgatttacagcagcgacaacaacaa
caacagcagcgtcagcatcaacaactgctgacgtctcagttgccccagaaatctctcgta
tccaaaggcaaatatacactacatgacttccagattatgagaacgcttggtactggatct
tttggtagggttcatttggtgcgctctgttcacaatggtcggtattatgctataaaagtt
ttaaagaaacaacaagttgtcaagatgaaacaggttgaacataccaatgacgaacgacgt
atgctaaagcttgtggagcatccgtttctgattagaatgtggggtacgtttcaagatgct
aggaatatctttatggtgatggattatatcgaaggtggtgaacttttctcgttactgaga
aagtcacaaagatttcctaatcctgtagcaaaattttacgctgcggaagtcatactggca
ttagagtacttgcatgctcataatatcatctacagggatttaaagccagaaaatatcttg
ctggatagaaatggccacattaaaataaccgattttgggttcgccaaagaggtacaaact
gtcacatggacgctttgtgggactcctgattacattgctcctgaagttattaccacaaag
ccatataataagtcggtggattggtggtctctaggtgttctaatctacgaaatgttagct
ggttatacacccttttacgatactactccaatgaagacgtatgaaaagattttacaaggt
aaagtagtatatccaccatattttcatcccgacgtcgtggatctactaagcaaactgatc
actgcagatttgacaagaagaatcggtaatttacaaagcggttccagggacatcaaagct
cacccatggtttagtgaagttgtatgggaaagattgttagcaaaggatattgaaactcca
tacgagcctcctatcacatcaggtatcggtgacacgtctttattcgatcaatatcccgag
gagcagctagattatggtattcaaggcgatgatccatatgctgaatactttcaagatttc
taa

DBGET integrated database retrieval system