KEGG   Saccharomyces cerevisiae (budding yeast): YPL203WHelp
Entry
YPL203W           CDS       T00005                                 

Gene name
TPK2, PKA2, PKA3, YKR1
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK2
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Autophagy - yeast
Longevity regulating pathway - multiple species
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    YPL203W (TPK2)
  Cell growth and death
   04113 Meiosis - yeast
    YPL203W (TPK2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YPL203W (TPK2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YPL203W (TPK2)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   YPL203W (TPK2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YPL203W (TPK2)
Chromosome [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YPL203W (TPK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
UniProt: 
Position
XVI:166256..167398
Genome map
AA seq 380 aa AA seqDB search
MEFVAERAQPVGQTIQQQNVNTYGQGVLQPHHDLQQRQQQQQQRQHQQLLTSQLPQKSLV
SKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERR
MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA
LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTK
PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLI
TADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPE
EQLDYGIQGDDPYAEYFQDF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgttgcagaaagggctcagccagttggtcaaacaatccagcagcaaaatgtt
aatacttacgggcaaggcgtcctacaaccgcatcatgatttacagcagcgacaacaacaa
caacagcagcgtcagcatcaacaactgctgacgtctcagttgccccagaaatctctcgta
tccaaaggcaaatatacactacatgacttccagattatgagaacgcttggtactggatct
tttggtagggttcatttggtgcgctctgttcacaatggtcggtattatgctataaaagtt
ttaaagaaacaacaagttgtcaagatgaaacaggttgaacataccaatgacgaacgacgt
atgctaaagcttgtggagcatccgtttctgattagaatgtggggtacgtttcaagatgct
aggaatatctttatggtgatggattatatcgaaggtggtgaacttttctcgttactgaga
aagtcacaaagatttcctaatcctgtagcaaaattttacgctgcggaagtcatactggca
ttagagtacttgcatgctcataatatcatctacagggatttaaagccagaaaatatcttg
ctggatagaaatggccacattaaaataaccgattttgggttcgccaaagaggtacaaact
gtcacatggacgctttgtgggactcctgattacattgctcctgaagttattaccacaaag
ccatataataagtcggtggattggtggtctctaggtgttctaatctacgaaatgttagct
ggttatacacccttttacgatactactccaatgaagacgtatgaaaagattttacaaggt
aaagtagtatatccaccatattttcatcccgacgtcgtggatctactaagcaaactgatc
actgcagatttgacaagaagaatcggtaatttacaaagcggttccagggacatcaaagct
cacccatggtttagtgaagttgtatgggaaagattgttagcaaaggatattgaaactcca
tacgagcctcctatcacatcaggtatcggtgacacgtctttattcgatcaatatcccgag
gagcagctagattatggtattcaaggcgatgatccatatgctgaatactttcaagatttc
taa

DBGET integrated database retrieval system