KEGG   Saccharomyces cerevisiae (budding yeast): YPL256CHelp
Entry
YPL256C           CDS       T00005                                 

Gene name
CLN2
Definition
Cln2p
Orthology
K06650  
G1/S-specific cyclin CLN2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(64977..66614)
Genome map
AA seq 545 aa AA seqDB search
MASAEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQSCKFKPNPK
LIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYCSKRIVLRDQAKLVV
ATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFL
QMERHILDTLNWNIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSD
ATVDERPYQNEEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQF
TNQDHGPFLMTPMTSESKNGEILSTLMNGIVSIPNSLMEVYKTVNGVLPFINQVKEYHLD
LQRKLQIASNLNISRKLTISTPSCSFENSNSTSIPSPASSSQSHTPMRNMSSLSDNSVFS
RNMEQSSPITPSMYQFGQQQSNSICGSTVSVNSLVNTNNKQRIYEQITGPNSNNATNDYI
DLLNLNESNKENQNPATAHYLNGGPPKTSFINHGMFPSPTGTINSGKSSSASSLISFGMG
NTQVI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgctgaaccaagaccccgtatgggactcgtcatcaatgctaaaccggactac
tatccgattgagctatctaatgcagaattactttctcacttcgaaatgctgcaagaatac
caccaagaaatctccaccaatgttattgctcaatcatgtaagttcaaacctaatccaaaa
ctaatagaccagcagcctgaaatgaaccccgtggaaacaaggtccaacattatcactttt
ttgttcgagctgtctgtggtcactcgagtgacaaatggtattttttttcattcagttaga
ttatatgaccgctattgttccaagagaatcgtgttacgggaccaagccaaattggttgtc
gctacttgtctctggttggctgctaaaacttggggcggttgtaatcacatcatcaataat
gtagtcatccctactggcggaagattttatggtcccaacccaagggcacgtatacctcga
ctctctgaactagttcattactgtggtgatggtcaggtctttgatgaatcaatgttttta
caaatggaaagacatatactagacactttaaattggaacatttatgaaccaatgatcaat
gattacgttttaaatgttgatgaaaattgtttgatgcaatacgaactttatgaaaatcaa
gttacttatgacaaacaatgctctgaaaaacgtcagtctcaattatcccaggatagtgat
gccactgtagacgagaggccctaccaaaacgaagaagaagaagaagaagacttaaaacta
aagatcaagttgattaatttgaaaaaattcttgattgatgtatccgcgtggcagtacgac
ttacttagatatgaacttttcgaagtatcgcacggcatattctccattatcaatcaattc
accaatcaagaccacggtccttttttaatgactccaatgacatcagaaagcaaaaatggt
gaaattttgagtaccttaatgaacggcattgtttccattcctaactccttgatggaagtg
tataaaacggtcaatggtgttctacccttcattaatcaagtgaaagaatatcacttggat
ctacaaagaaaactgcaaattgcatccaacttgaacatttcgagaaagcttaccatatca
accccatcatgctctttcgaaaattcaaatagcacatccattccttcgcccgcttcctca
tctcaaagccacactccaatgagaaacatgagctcactctctgataacagcgttttcagc
cggaatatggaacaatcatcaccaatcactccaagtatgtaccaatttggtcagcagcag
tcaaacagtatatgtggtagcaccgttagtgtgaatagtctggtgaatacaaataacaaa
caaaggatctacgaacaaatcacgggtcctaacagcaataacgcaaccaatgattatatt
gatttgctaaacctaaatgagtctaacaaggaaaaccaaaatcccgcaacggcgcattac
ctcaatgggggcccacccaagacaagcttcattaaccatggaatgttcccctcgccaact
gggaccataaatagcggtaaatctagcagtgcctcatctttaatttcttttggtatgggc
aatacccaagtaatatag

DBGET integrated database retrieval system